ELF> @@8 @@@@88844 ==0=0ԷxS 0f0f00f0TTTDDPtdBBQtdRtd==0=0p2p2/lib64/ld-linux-x86-64.so.2GNUGNU=z"lf04R-T 00 #!JzdAPDDB  @AJ!IhMa"r 6NL@@@AB 0Iq(h @( H +H&R€D!D  $DJP` @A4`@ABd L@0 dPCDB@E % 32BX@TBD$ @ @A%  !0`0 h@@ bBh HBHD`1B Xq@ Y BdH(0"BB1@ p2 IP8@ s0 "Bi$$DF0" )4$ @DXAp @B82 BH  & =HdL@0( 0D@kBDH`$yh@(>5R @!%) PH bPAbBP@(L.<B@&JD08` PPQ0D`` H`P30! BL 9E$!( BD@"@@ XDBQ( h@#6A`/#( G80DÐP "$ctRp  , BAɪ@ 4d1ÁdAD  `H2`NR l1C  "7$aD!A8P_P YϚH (B 1@;hȀAEn" L F   F`"`% H0A`k $&# Z4%D"hV#@@`@CE@ F9$@ H(A@@P @B @@ @9 @SF DD ̀ @@0  LDo b I.P(]`! H DJHap5 B(HB A@ E< D$@ Sh & " 8 B0&  @C tP"T 0P e @AF($B !Xrd. 7M< "  "&"P H!`%`A $"A ` 0  #FA!I`7@`/ ͨЬ@)CQFAh`,b#  @D X!@@ @R 2(aPHpJe$@HZ` %'@ 3@D xA  . & t8`Đ) -"$Y"(A !C)pZPE@@@( )(@C4#DS_ T$ D @Rq&51H@D (B(I("H f j P$H " 20  #& (CP$r`Dd$"7A0D@!E0@@4b PHP&"PJ` "@ BPrD  (vI6    !"#$%'(*+-./3568:=>@BEGKMNORTUZ[\]_`acdefgjklmoqrtvwyz{|}  !%'(*,.0458:;<=?@DFHIJLMNQRUWYZ]`acdfgijklopsuvxy}    !"#$&()+,-./1345678:;=>@ACFHLMNPRSTVWZ[\^_`bdefghijmnqrtuvwz|    "$%()*,/156789:;<=?ABCDGHIJKLMOPQRTUVWXYZ[]_cdeghlmnpqtuwxyz{~  !#$()*+-./23589:<=?@BDEFGHJLMORSUVWZ[\]^`abhijmnoqrtuvwx{}~    !"$%'()*+,/0145789:;<=>ABCDEHJKNPQRUVWXYZ[^_`abdefhlmnprsuxz|~   !"#$&'(*,-/0235789;=>@BCEFGHJMNOPQTVWXZ[]`acehkmnosuvxy{}    !"#$')-./03467:<>@BEGHIJKMNPRSTUXYZ[\]^`abcdefghiklmoprsuxyz{}~              ! # ' ( ) + . / 0 2 3 4 5 6 8 : < = ]De' n lqsm#*K4EW5æ *N?me")T8*C8z?yk\3Ӫ˝İ{+ߓƌqxI{?4 ajW{o3k2!`혍:ZkY _ȕn5;i z%#a铁iDi_ñm\YhFL`I{A4{WǞ Pt/hYNm6 T>SHrwYK8nٻ { iNAo``0Tr@#V;%R ymnu&g:d*:f'46bKV&c.#^qLw*{n{ߣ%ԯ*cV_S"$Ry$oETjtIJ'#/Y} ?U_EyQq,~oMOI;r;Yu3w":{ٛ|/5רFM'8`͊#' h^k_|In&'_,@͗WO3C =ךW}@yr5؂jP#';/eɌU7cMu=O%u҂]4Yx,Yϻ:wXcx(36v]bv~k iFbxYΨI3Hxbb][1qo`9 37_2y ӣ;̬*)gaj|:𿣠~){Di\99,%2R;N3N'UOM c_ Q~0O}F(~T+`…+*! J|tG}%|)ؑ®Aw glj`3w1tguoBK+uV8獔! Ź@Η[-&F7'.c3'R0Sq=Z).Hˊ\:G iʝ. PMH[+Z=A,"yHB+O?@TB= @#ػЀ}+)K{1enF_KQݣk-qCAXZgߊ.M{٦a67׉]BZdq83-{k+A,ƀ6mm}LdY_V<Ͷų`_dJC|2kbm-\+oGZst#\Jf <ۇXqжUj_+_2V[m#AasC,_?و ~4jnʗKxpw֞M[QGq&!&PJ[]t:q٤-N|}E Nr/oQ)/χdlF2c7;YF ai[(Q+ldz^w8~e5U@Z,5wʓo7};HrcesFzeXmeBe!1S!y^PQpQHaG;iRԵvyb؇C U+5%qGQ-q eȩU׊JB,+S{{CE 2(=|, ~BVA6=<+BeAh3Y?,JMl6 ?_+c&̟hIiۓ5Y_t؆\osv#U`D;%k{ d˥D'\Kߔmj1,Ĉ\cK^__ G>+ *B-=Un#|QRUM&Zu'iÄDG^2BTz:ul/Odsw-"n \I> )NΒyE%*頒J_2 @]u%k0Ej>Xm 9q_t΢E:<)d\;;ExK Q;CbIw`#U設K향-m<{Wzl|81t\ #wnsB2ld#ߦ 41:\H ޥ,8URCض x?޽ o\>aGޫ$ ]SU--6Ɓ޼)G$Z9Gbul@*FfQƴ7Z3B.h OGu8W@M>>o0WIs՜Y47*j9ٍ(xV;wTbhG",[0sC5rmb'!Kz=[o~ah!|W,fi&) 5 N\fcH)W,ZxsYAR Pnnnks\ȣ NKYkʦg*+2`/VaGGEtWi)d"4y}l0zx%2j CM#KQ@7,zE8~-w!7^ GZ9 Jݿfo3БѹOHM߾Zx} = ޕWʊp[4@^l>Y)@%3 =^MD*沥Q >S.8 2(PMky+8uJ"s:BQCI}]ӥaޘ[Y?@=ateN )"J Yyʁ I =M[uiyيSQ'er+3)Y zkSf?g| H0ZZb sY{EXJw9N "cD9E'"hjg]jK Ym OI'k~[vtS# N(fr;-jSQ?ց>xwujE+J]u 6eM! Mao!LjlRuҊ_יHu+}w75 Tէٶq-GLX; Ky?W2]q`#6(Q%{q;b>yv tUy kJ/qj;>nrJУ)zkI-:*]2Vfkv;F:&S &fdؓe6Ot|>8Wn[ʸ .n;͒Ы#UUd~wA`(^rMo5bkV[˧LTYL/nsb$Um]"_AGثsP/  _7(S۟?S7-Fݙ:iX2hHΏ_TfM~GaW?Bas0&7=@ rۙWr\5ӹ[{$W(H *I)WJ%l> R.hP'6mo3LXoC?,zZ/#T:.7e2tp!ܙ$-wu;%R3}IJxV|1 yXW$JPLi(|+@=0 lJuU]'[!v,ʁiPnSLhfz(uCՀ1jWw2rF܉YEBE?P  ,/U4N4bŧg"҂(9AE>$akXB#za6_1P|-wpt 'aWrOf:6qZ/-XN aOހmr60YA6ÏC-t]'t[b/yoڸPY<*~r` 6EjǏ"|A&LQ`HvNKOz?#PMpBqa9hyez`DQuXx$MmB쑐$kk-g0'Fpóy㋚/) ūS'&6i Um`O mj'&%L;ByCkU=1 h<ބt;i49 ;7jeGW8;Ũ: -6sLlSȘ=s)CbAY5ɍ&C7<>*֖V*^p$!"Hb(I\ yyi^+:n'wSoSĊtSoNm:U.|3d.(5 e S0}y^ ]\Aid\qJ}Gr,r Tvڱ x%O.QJI%x`)u98ȟM]?Cfo=#I "NAC!)\-ԁ98Gk+w/BCH$~dÂSYu$DX1$t8xB4PP-j.Z̋)U  b)щj"Js;ѿ mN<)//aH#Wݸ63ű}-}KMB.lUa8qbOWztYa8$FMߌ4^0b3iw5͢mcYcF,2=iR"Ď M߁cA(ϡ*>@yΉ5égܾ6eKb'G8(++75A}=:qž ҵ.Vn %!"OZŨ#r!+1]::OȪY5_X&rȂᢚվ e *քgw 3s>ӢCΞÑ7$ N@]D}\d H8)z?XTY DIΥ{ o Ymnblfگ" #@KP__jPl8Vcr X ίn-OtvAC:uYUg'&$(pB!9/B4`3kY+AD3T9y!Ka1ۜ^S"а$\æ&M/79't.&S/pG ղ]#p/n?x7Wпjl&3ˆ._FɌ~&*tvٳɵ13~?T15 b؂QD1]l 5i 9Ut10" nb0p?[RFPj[ZIu&9EK G suNl&`=b`ך5^s@Î;4Szz5TƝ,;=3%>l2} AiZ*#kiD7-*3 ]jd8Z ,JZš<3Ko[|=S -jOʇ3t% "pH}GӳYp^_e% N$Yj-=߆2ηR-Aj'Dj~ WODMrZXe裞L;Y蠇R b0 + Z݊5sܿy8P6~U|'dԃ\Q0XcV*)Nd9MJq[E~߼ON;"?G)oOu@ dkMfKwp嫐LFB& "ii7(S˛!tNYTanB ] !4e7Z Z ֬$k|xI 㣼,ޗ?'% o7<kUϫ+OqҠp7۵4))i^%p3lhvyd55Ű!uPN~v TWW4=%- [N@ Wsr5N)o-6ϚțN-c&R-6*mՌ/pÛu٬K3Xf$mgq6JaOfFNK>`T;Swݻz^D&yp/pRDQTǾkq`i};HPAw5yѕ9p)R{4a@cХ..C֓_VpIHl;QiCpxY^_/W7d xz ;{'핺އta2ݸC y"5t=TBRϥŀe a֛T"BsMysHB]bj5юMm_ˬϾ- ؊35g&?H0Q )3TP-&$p)1A1ez1O~D1,1PP_o)8L0A:!9ym d$@T q%,<Up> S.h 1 1{X4>11 JPV È0Zrz00;1T/[& Ս 1 IV %} GJM jnv SwЉ |Ъ ?dГ +?@ Uf )d 'O`K3m=P0Z]dCn 1[+TqPIV"^ 1`4z t? A1K 1` I -0(IA0;Vn` j_ <_ e|<0: )R2@7}`\ P#' `w0HC 1pOP |d 0vi0Ą )1t ]0}@1"f"X:csp `p6n(` 2~g|pX d$k46.a2 o 0hX ),1/T017Ш'q110$=0C0f2P o_70F]0ZpB0Y`1ӑ ~PV }V MSj@0~L 0 RkC0$0 $P 'q j `3P11BN| .'`_nip @@B0ŀ!hPD0^pzaN h6 h7P [  ŐMV9A;A02`2(H$1h@D0*[r p?? Pw~0(< [<'19a~0(R`T@ X A10{0 lhp ;=140'.,mА1i hI@1y0CD@ BEwk0>  SPB0YF3 1610 -hp`}0 RF@13p S9^I K( JD eNB0W ԡ0oDp0H\ g0.ul`U7&jw2GR`` W`1S1S NY:@K PJ4"qL(WHlKp  1(P13Y4sPx pZ P  S {!0G4,M0q ##3#n0C ~Nlc 1 (%80C1KP0kcP y~{r8 RP` '00A[WKT 21# b |0t *gp qTz@  2N11PJM5 Uh1*o:4@L :02H=1/D ' c$=0h3CBn  9J$JHh ac0D@  B~;X1~w >TyV z} %0P? ' 1&V 17kT k<( |Jrh#e Z p7  -7p9] :*@c+}@%O A.@qN1&G 9Y0 20:i^ ( S& F_@&cuP% +`5P 1Op)`B0)11 H`V0i0F0z ܅Vd@ B0S-`:Pc@O H~0ap %=@ky ;8'1"v@ (KFX1`Md 01E0%X o ; !TP lS\0ht01G qY1,j%J 1JWMHa0$8 yp+X 1'L@1a?bn:.1xg`f}R 1Fg'*2` wPY g@" ?01-_p01r 1 Tl01h@"Y$1/0.F KP4*<{`b1" jP+0 J^Gk B'H14 ?g(a214Ga 4IY$ vQR _b ,/1'B @2m D~@ lid5 }0) AP@a8`7W4" 03"Sp @t0FPg?; # h GCVy!Q[ }%P 9a{`W;=/ 1A1D h\4 ] L0    `. \ . |0 3@r bxl1"U@0xHSf|0D?y)P?"1PaK @0R?1{*p D0J@C0x 1  -Zr" m`GӇPY<@T˃҄,1_ 1K `' @310`G K;  [ ( i0 *{ vH LK8C1oQ` i>0pL\^ H2y "yMw Hs0*7P %'114p k&kp#I;81r G0 !N`| J W~A0 y. 61 T _;0] M6 `5Qu[ 'jFl5 = ` w Q?17fp?0!Xl]pk ~=^0(@Z v)6 gМ=. iu^*^9 8 DD0t?C)% ?j 0L?1Dl01c$04 RO +D21# ;1_` RS  D02p KRS0cX` 1T0 Sxp P`7v0}t3Y9u@X^I@0E?10@I*CD%>0( 0v$P %H1S 1g9 4 ``v^0'@G,1bPA0 n % . ASН p  +] 00 ZT A"1>80D$1~| >*8I-Gfء0mP@%21=KB O:1pGx1HH hd 1P 1 APz rk-1$0i`0(fХzPNjP 7"Z D`n t,JYx0 9@ CbW$1p>N Az w&1v1#5,0P@ t0pU ['@t\0  PSwRx^`k /$ I?1At0PxP$1U 0(yz@C1j`,5P{ * Z-e0)/P ?Fi FM0)0a.`geuD0 ]p j 1i_ j ne?(A1"C` f8н/t|0 mW '>Kj]I301%p 67R\01%cn"Q+лk a Q5|0(7B0H 3(C1F_"R@b0Z HbF16?P *6 p 1Y:0p$p0up ]F010z@0,1  KJ TJ3 EWIZ PK ^q`u *\D`f0K1 @apMR+G)[ ;B@J-4aBg;i>_i`1jP +V Oe84V A ]1tH)1C0܌ 0rb1s# +U KZ<_ 6K=  1}TwXt0"-#{0M1Bp0X0{W,}L40]@0V aK?0$  i ` 0 t `C1T_"1n'w0B8?0;܎1H0yx!`IZsPj}r r{ "D Q H eЭ @1Um +?1; ?0-pA0q080 x)) p9: A0W* R l^1>:1NVd:V- W-~,=D0%em`0AX0Wld?1x"1з voU EUQ eS-ZP[ 1Fȏ1i "`0(q0C   "+ |2 5 +k11 @ ;1= 4PU`#* p y aZjA090P& (CС b0cx01]@1_^@  W1 2$d0`v m!_06L$1Zd   0)S~%@:9@s )<k{ 6G_6&z)i( 1  @X T4'14cPl L_-01L_^ pUx ;|1@D [ ?Gu0N I4u;1Ai  17 y0!P>" .q@0W MP (@1K0T  \ bx@Z/؎1518WS dl&-J7 =G-5d^}GG `$@15PC0_1g,9d /6pJb lu|VYP05mRO Z= u mr"0 $ J8-1u  UB0Y0(&Ё jYG҈fd3t ;1t7P1 p8 9qT`*V0l#:Z nI  %> W>4vgp(*.@ =v  B0vp Md`~0(  KPU`v_ #;I .s00p # ) 1l"1`?m@ 8U:60YI),1` [cpoBp ]^ FL Ey0%`+`(1>V !m qe0-1UpP f` };0w* 2ӂf"1s kHX01:pC 7Ywl LG1^ e`#@ u@8w0l@0<0A0~5 1b,1: X z1  5hC15P n{ 1Ypcb ^ r0'rh, saP OhO0|k:1R0op` !?1o::'7 { v . su 0(5 ^ @{(w0CD psP g%Y2)p!e6pQ|;*] ~7, Ld *B0 IX .02 Ta( y9^ a 1Ȏ1c1|Gzi1 t 9X@ 4Nw XvPBЁop1Ko Y1(LRp~ }gC= )@0/,1G ^ jw4+S ai`Z}0@0y0 rP# 91s /c\0("6O0  ?)1y1p) qnC0 0[ =M> X% FlqP3MNLpC0`SA0!Y0h M xR tjhZ@c'@F +0a 0aT]n; *Q00k"|8012(@T``1v`e|[ a m 0 C0/J ;_ d019{Z5yEd01rPh!p `a :4P'vL 1Vq c p 1 p0*Rx 1Y^ 1p ^2l GuX'1m6p1&[~ mХRA0hT0F CQ/X1z u)70j 1e0ei&} P1%P;@;P1q1q 0/0qi4n?0| Z)0 X 1.H0UcjY`}  "/3B 2;@e 1*pra`lf"" 1, -;oB0Bxt 1-A]@@. jy TOx?0w6 0c{PI f ~"21EX Z 3#Юee bupP B0LM #; 2 W4` ?~/1ɂ 1^Q +` M1Go@( N-1&PV|18Jg 1^E 4g+2@ ul'1,! '2('1Fk Up 4`-1 0*=x 84пAUC|P5 -WQЏ )` 9b&a`Agp0hR`%n1h]`fL0Zb> ypn@1h} L~   jԉ@ pH-1' pT-9 TPs0EZ\ M[o +,GZ`2 Op'=pIE. $R&1R   0(,g(40 UPX K#pet! $1Zv Q[j{0r0,u "h! c zZ,0[Xt1C, 2%`v TZ2X?0 } @PHqC10{cPHBБ *?0~gHg ΋ 5N@` 0=>`01A,1g K`0 M{ `| KD 1QEp1S@64 P 7[Vk }h-110]01b`,8T1<P$ ^P /|0`@ cC1P2160u -/ph1, EmP rTI+`4t w~`aH t0( E`%Qp t1>e /,`B1C|p0$#0$1@+@O*? Z8R`@0 y :p1e,18А%6 N C0p8B@$1(P =FWP eTa 0tq@` ~u_ L{oN"?0?K0H0#0mtK0 xPn*%TB1M3w#y@01:, J)0 C60A0yMfA1! PW = - T2w/1\u$n1\9@00V PJ\ y}v?0P`%21@?0<;P=1` B<p%[  f(1jx1[PSC@ K0`WP3 z\% mWDA1|IRiH ,aD1 A0%3g'}@1-I0wЏ1X&; gd02U,0l?1ŏs1@ {|?1S.@c0':L1[@p0(DH zM-:@1OK@1- 5( Y 1 +Fr0Ox?1 - @k CP Fd$C }i 5VYP  _ }0(zȐ1i DӃg'Eo؏1L6 _" <5@"$m1T0oOB +5k0iBB H01hp8:vxp0 l A0N0Ts 1+pT @ @1#Pl [G 1aa j@,-1q`h2`2 m1AmK #8 o+1ow0 kh1P0e41H 7 I#,1x t %x N`C0S>a$]<0VE@v4C@ U0p?1k?089 jp@ p%K0 #P]О0 ,3G 10| 1 30E3@y ),  `fT kP 5,Ў1RL B0o~ R@;f_p] 4rV4 osP'1>y d` =X1]0))X;1 6P9UiHw0GJ D0@i {p| -8e)XPQ}.B aq@0\(p0Omp Q e"_1 zN[pP<] 5 +O @ p BzP ~``Z/p %FIPM  iN1(0o1H"1T8r-^ z8DlJW Al0Pp PC Da%0Z4} lZn [N,w0p -TP%iP0`)N53o_ԀP 62 RE?19S 0Q\1|P3)B01?0@\ Bp c `V , 0(&07&& 9w>0u KN> eJ}  11|0.D@tn\ L )` 2kNOxR@ vkVlC1 -0(,:[h0' 0Fw ܄$1,{B6~# { :"J0>PH1J0D0/6Fs5`8608R$D0 XJ W0 8z!0pJ$t0'15G <>> v# DoxL`h'1t`?P5+IRP:>= 8` qE!`nm$2p#qM&   T_d'1q D'YTh01xP/*,1@c JЬ2 5z zJY n1Z 0, 'OiP01k&40+0e%v uC0pp  g1 1gk O 4 A1kAЌ \$\1tpW :j . h&0>1(b#3c8}P)1v0 BZC0] D1@v{С0Up iSy~3!vZ0m1v0@X /A1*"17 E~?1A1 Zp P 1vd X0Ryaf0Ѐ x-1!h?1@)r`Gs]M0H ZWpe|  LC1#; ]H1[Њ05 wl@ h!,,A ,PB1t,;1\` ` 3j &0r0p= C;@$;<%0#7X1=FkPw1+1hs +0i H`d5L4@{ $S8A1 pP "L=1]g`:zn0b,$1.;YXKЛ Um<1Qpp0L{@ 8IAbE1)Z''x?1"75 T& /  ] ~c :Ь L0"WO؏%.0 P 3Fpw 0@ 'y 0(\  0 V`B$l-1^P9 ,p@  3b '8'P4 Jd 0- _2 !?@1܆ `:0X"Q@0܎_ !0  1E010 IPS 0г< DlIC(W@=1wx0e  "D@% A%001`H0] cT {#0 6? *R&/t <@F XЛ K0/`D<0 j1m 'E) 1uR1Z@ *ݐp' ,H ~0(^/c7D 0&L`v^s0n] 1 I/1p/1cEPQe@  @ B)g\5 VP-1}mn  1 ``A09n43:A0d@_ BBiA0y~ܡ0y ZA 1SP:M o "0w0U@1:UVؐ1^pYP3p0!I@) = Mfi0:@\ aP kj01: 8Z:1n0> 0 11Bh1"0HC1.@@00}S(-1e. 8E{āB/] $Lt0fJ 5 Br'1+/148l9,1q}P2 xI 6V au11PO1P!1 x/w0(Va0i Gb` a" S` 1.^ ` Pfp B /s0(`rO1pq -s.,XьyAP: 3 u,v @v&t`@z/1+A1|Z* D!0b r1; -1:15O :Q Yw0F6a-o $-p[ D~U DV@A1vV y%Lw0 1"D`B0 1}FI(Y`ϊ@U0Y 1g ,-  MTX *1_'R@2@ X-10p w0X Zkx tj #2 P`Pp. q7B~Q`w pF`0(xIP139 DG0{6p O =km_@tKZ0C0-@ RN0(-h@5n4?1uw0 Z@r3P FC0U !*`GQb w ;v/ 1$ P.c1x0 #3`lqZ%1?Fo/`Me .wDw03T w% +[XPdg(aMG /5P 1+ OO` wimJ:3) "L17 P@0  @ wh0A~1R S|X KՑ XpB0!.-  wR#+@ aB =C0s5,~ c>1hy`1@dw0s+ 004U2L1libtinfo.so.5_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTableUPtgetnumBCtgetstrtgetentPCtputstgetflagtgotolibdl.so.2dlclosedlsymdlopendlerrorlibc.so.6setuidstrcasestrsocketfflushstrcpy__printf_chksetgrentreaddirpathconf_IO_putcsetlocalembrtowctowlowerfopengai_strerrorstrsignalstrncmpdcngettextgetpwentsetserventstrrchr__longjmp_chkregexecdcgettextwcrtombgetpwuid__fdelt_chkclosedirstrncpysigprocmaskregfreegetgrent__stack_chk_fail__lxstatunlinkputchariswprintstrtoldtowupperstrpbrkgetpidimaxdivstrdupstrftimeiswalnummkstempiswlower__ctype_get_mb_cur_maxendpwentstrtolisattystrchrnulfgetsgetpwnamgetppidwcschriswctype__mbrlensetitimersigemptysetgetaddrinfomemsetlocaleconvstrstr__errno_locationtcsetattrchdirconfstrmemcmpendgrentmbsnrtowcsmbtowcttynametcflowdup2clearerrunsetenvwctob__fprintf_chksigaddsetiswupperputenvwcswidth__sigsetjmpstdoutfputcmktempgetrusagefputsstrnlenlseekmemcpyfclosepselecttcsetpgrp__memmove_chkwcscmp__strtol_internal__vsnprintf_chkstrtoulkillpgstrcatumaskstrcasecmpsetpgidgetpeernamembsinit__strncpy_chkgetgidtzsetnl_langinfoopendir__ctype_b_locregcompstderrwcwidthsigdelsetioctlgroup_member__snprintf_chkgetgroupsgetuidreadlinkgetegidsetrlimit__fpurgestrncasecmp__fxstatfilenogethostnamechowngetcwdfwriteiconv_closegettimeofdayrenamesigactiongeteuid__memcpy_chkwaitpidlocaltimestrchr__vfprintf_chkmbleniconvfdopenqsorticonv_opentcgetattr__ctype_toupper_loc__strcpy_chk__ctype_tolower_loc__cxa_finalizefreeaddrinfosetvbufwcscollfcntl__sprintf_chkwcsdup__xstatgetrlimitgetdtablesizewmemchrmemmoveendserventbindtextdomainwcsrtombssetgidfaccessat__asprintf_chktcgetpgrp__libc_start_mainsetpwentferrorstpcpywcslenstrcollwcsncmp__strtoul_internalsysconfgetserventwctomb__environsigwinch_sighandlersh_modcaseparse_shelloptsparse_string_rl_set_normal_colorprotected_moderl_show_charrl_byte_oriented__libc_csu_finirl_filename_quoting_desiredsearch_for_command_rl_eof_charxdupmbstowcs_rl_start_using_historyshell_glob_filename_rl_intr_charsourcenest_maxrl_outstreamsh_get_env_valueuitosclean_itemlistrl_discard_keymapalloc_pipeline_saverrl_vi_domovedeclare_docrl_digit_argumentcount_all_jobscommand_word_completion_functionrl_executing_keywcsnwidtharray_dequote_escapesfind_variablerunning_trapbreak_docjobs_docdirspellcoproc_fdrestorefmtulong_rl_last_c_posshopt_setoptarray_dispose_elementset_shellopts_rl_fix_last_undo_of_typepop_args_rl_isearch_dispatch_rl_block_sigintlastpipe_optno_exit_on_failed_execshould_ignore_glob_matchesduplicate_buffered_streamrl_bind_keyrl_completion_append_characterbashline_resetrl_begin_undo_groupgetifsexecuting_builtinrl_input_available_hookall_digits_rl_clean_up_for_exitrl_unix_filename_rubouttempvar_listcompletions_to_stringlistget_current_prompt_leveldiscard_last_procsub_childpat_substadd_or_supercede_exported_varrl_insert_textrl_replace_from_historyshow_name_attributestop_level_maskbash_initialize_historyunbind_variable_noref_rl_input_availablethe_printed_commandadd_unwind_protect_rl_want_redisplayrl_tilde_expandvar_lookupfd_ispiperl_tty_set_default_bindingsno_symbolic_linksstrvec_from_word_listexpand_string_unsplit_to_stringreset_mail_timerthe_printed_command_except_trap_rl_free_match_listset_default_localemake_while_commandassoc_patsubemacs_standard_keymapexecuting_line_numbercheck_dev_tty_rl_keymapreset_shell_optionsbuffered_ungetcharyynerrscleanup_the_pipelineu32tocescrl_vi_end_wordwmatchlenread_tty_cleanupdispose_function_def_contentsrl_reset_after_signalrestricted_shellterminate_immediatelyrl_emacs_editing_mode_rl_push_executing_macrohistory_set_history_statehash_doczwritearray_shiftsignal_is_trapped_rl_suppress_redisplaybash_tilde_expandulimit_builtinlogout_doc_rl_free_undo_listrl_vi_movement_mode_rl_init_terminal_ioget_dirstack_from_stringrl_vi_columnzmapfdselect_docwdcachegather_here_documents_rl_show_mode_in_promptrl_get_termcaprl_promptprint_rlimtypedstackrl_forced_update_display_rl_backspacetrim_pathnameadd_history_timerun_debug_trapclose_fd_bitmapbreak_builtinfind_variable_for_assignmentsv_histtimefmtclose_buffered_streambash_getcwd_errstr_rl_callback_data_rl_digit_valuebreakinghistory_lines_in_file_rl_move_cursor_relativeglob_starconvert_var_to_arrayrl_unix_line_discardbash_copyrightsubshell_envpremember_mail_datesfg_docbuiltin_errorbuiltin_address_rl_current_display_line_rl_skip_completed_textremove_backslashesfree_mail_filesparser_errorrl_special_prefixesrl_backward_kill_wordrl_last_func_rl_executing_keyseq_sizemake_variable_valueSBcommand_errstrcoproc_fdchkmailstatexpand_words_no_varsu32cconvit_arrayvarsglob_patscan_wcreader_looprl_kill_regionrl_forward_byterl_noninc_forward_searchlocal_exported_variablessh_syntabsizrl_completion_query_itemscoproc_flushmake_command_rl_interrupt_immediatelylocal_builtinrl_set_markhostname_list_initializedfind_path_fileassoc_insertfile_exists_rl_to_upperzcatfdsv_execignorecaller_docexpand_words_shellexprl_bind_keyseq_if_unbound_rl_uppercase_prl_bind_keyseqwhich_set_flagsrltty_set_default_bindingsifs_firstcstrcreplacecaller_builtinbind_keyseq_to_unix_commandexecute_variable_commandbuiltin_warningexit_immediately_on_errormax_input_historywhere_history_rl_dispatching_keymaprl_alphabeticfind_string_in_alistpush_contextjssigint_sighandler_rl_internal_char_cleanupprimary_promptmbschrredirection_expandhash_builtinshell_initializedsh_contains_quotesset_compatibility_optsrl_reset_line_statett_setnocanonfg_percent_docbash_logoutclose_buffered_fdttrestoreifs_cmapdisown_builtinfind_or_make_array_variableglob_patscanrl_gnu_readline_prl_attempted_completion_functionarray_remove_quoted_nullssh_statcontinue_builtinglob_ignore_casestrlist_resizecoproc_setvarsbgpidsfind_variable_norefrl_forward_wordrl_binding_keymapdisable_priv_modefalarmarray_rshiftshell_version_stringxbcopystrlist_flushposix_readline_initializerl_sort_completion_matches_rl_vimvcxthistory_truncate_fileprint_arith_commandtest_commandrl_completer_quote_characters_rl_susp_charsuspend_builtinfnx_tofswait_intr_flagis_basic_tablerl_callback_handler_installcoproc_fdsaveexpand_prompt_stringgrouping_braces_docrl_tty_statusxtrace_resetqueue_sigchld_trapset_sigint_handlerno_empty_command_completionrl_complete_internalbase_pathnamealloc_word_descdefault_buffered_inputaddtimevalrl_complete_with_tilde_expansionmake_coproc_commandarray_expand_indexalias_expand_wordrl_variable_bindsecondary_promptarray_modcaselist_stopped_jobsstring_list_dollar_starpop_var_contextenable_hostname_completionpush_scopemaybe_make_export_envarray_shift_elementcopy_function_def_contentspush_streamevalnest_max_rl_horizontal_scroll_moderl_completion_matches_rl_kill_kbd_macroget_minus_o_optsecho_builtinsh_optopt_rl_vi_cmd_modestr_lenbuffered_getcharrl_free_line_statereturn_EOF_rl_strip_promptcurrent_fds_to_closerl_read_init_filebg_doczgetlinerl_macro_bindrl_set_keyexit_builtinlet_docrl_funmap_names_rl_read_mbstringrl_parse_and_bindskip_to_delimsignal_is_specialnotify_and_cleanuprl_vi_putmake_wordbuiltin_docdot_found_in_searchtermsig_sighandlerlocale_mb_cur_maxread_commandflush_temporary_env_rl_nsearch_cleanupttfd_cbreakbuild_versionexit_docrl_vi_bracktype_rl_parse_colors_rl_nscxt_rl_term_autowrap_rl_sigwinch_resize_terminalsaved_command_line_countcurrent_command_line_countcopy_command_edatarl_old_menu_completeexpand_word_unsplitdo_word_assignmentfind_shell_builtinmake_bare_wordsetup_glob_ignoreread_secondary_lineshell_eof_tokendircomplete_expand_relpathhistory_is_stifledcurrent_readline_lineinitialize_readlinecopy_function_defpopd_docsh_quote_reusableyyerrorhistory_max_entries_rl_print_completions_horizontallyget_locale_varunset_bash_inputrl_forward_charreadline_internal_teardownreturn_catch_value_rl_isearch_cleanupprint_unix_command_map_rl_set_screen_sizerl_directory_completion_hookassoc_dequote_escapesrl_echo_signal_charrl_set_keymapyyparsewait_for_jobsv_strict_posixarray_patsubmake_if_commandit_runningexportable_function_nametimes_doc_rl_add_macro_char_rl_keyseq_chain_disposelegal_alias_namesh_regmatchtrapped_signal_receivedrl_completecurrent_command_first_line_saveddispose_function_defget_history_eventall_visible_functionsfirst_pending_trap_rl_set_insert_moderl_blink_matching_parenrl_yank_last_argsubshell_levelparse_bashoptswrite_historybash_badsub_errmsgcomplete_builtinlist_string_rl_echoctlungetc_with_restartset_signal_handleralready_making_childrenlast_made_pidzreadintrword_splitfind_special_builtinsh_optindwait_for_background_pidswordexp_onlyhistory_get_history_stateget_original_tty_job_signalssh_eaccessrl_forward_search_historyimportable_function_nameshell_compatibility_levelsv_shcompatquote_string_for_globbing_rl_fix_pointsv_mailwith_input_from_stringforce_execute_filelcurrentrl_history_search_backwardmake_local_array_variablebind_int_variablerl_vi_eWordset_login_shellrl_vi_ewordpushed_string_listhistory_inhibit_expansion_functionifs_var_rl_last_command_was_killfind_user_commandsh_realpath_rl_release_sigwinchfmtumaxarray_to_assignrl_filename_rewrite_hookpcomp_curcmdnohup_jobset_maxchildset_working_directorylast_command_exit_signalshell_is_restrictedmake_function_deftimes_builtinshell_ttysh_backslash_quoterl_ruboutstrlist_printsave_bash_input_rl_arg_getcharfind_global_variable_last_nameref_rl_next_macro_keyset_signalmaybe_set_sigchld_traprl_generic_bindinitialize_shell_options_rl_terminal_can_insertrl_clear_pending_inputhash_disposeget_name_for_errorrl_completion_quote_characterrl_unbind_key_in_maprl_add_undofind_index_in_alistdouble_quotes_inhibit_history_expansionreadonly_builtinassign_array_elementdescribe_pidunwind_protect_memrl_display_promptget_working_directoryset_if_notfail_glob_expansionlocaletransassign_array_from_stringsv_optind_rl_scxt_allocsh_getopt_save_istateread_history_rl_char_search_internalreturn_docsv_opterrterminate_stopped_jobs_rl_term_forward_chardircomplete_expandset_default_locale_varsrl_vi_start_insertingsv_funcnest_rl_untranslate_macro_valuesv_comp_wordbreakscommand_string_indexrl_function_of_keyseqsh_backslash_quote_for_double_quotespcomp_curcsttnocanonsh_nojobsuntil_docset_pwdfind_function_def_rl_output_meta_chars_rl_last_v_posrl_set_retained_killsphash_removeoptimize_fork_rl_parsing_conditionalized_outrl_getcrl_callback_sigcleanupu32reset_rl_free_history_entryrl_filename_completion_functiongen_compspec_completionsuwcachesource_builtinkill_all_local_variablesnamed_function_stringtt_setonecharset_pipestatus_arrayget_numeric_arginternal_warninghash_copyexpand_string_to_stringtilde_expand_wordtt_setcbreaklist_minus_o_optsfind_tempenv_variablerl_initialize_funmaprl_completion_suppress_quotesubshell_top_levelfind_shell_variablesh_erangepop_contextno_longjmp_on_fatal_errorwith_input_from_streamexpand_stringrl_vi_bwordrl_signal_event_hookassoc_to_assign_rl_comment_beginreturn_catchit_jobsarray_quotenetopenstring_list_dollar_atrl_deprep_terminalrl_vi_completeit_keywordsarray_disposemaybe_set_error_trapglob_vectorchange_flagsv_childmaxrl_completion_display_matches_hooktrap_docalloc_history_entryit_helptopicsunset_builtinparser_in_command_positionrl_revert_lineinitialize_shell_builtins_rl_make_prompt_for_searchdequote_listfind_variable_tempenv_rl_erase_entire_linebind_functionunbind_funcglob_asciirange_rl_unget_charexpand_word_leave_quotedset_signal_ignoredxfreerl_copy_backward_wordread_history_rangebashline_reinitializerl_getc_functionbuiltin_helpprint_commandparse_symbolic_modextrace_fpinitialize_signalsrl_num_chars_to_readstring_rest_of_argssignal_is_pendingrl_vi_checksignal_names_rl_clear_screenrl_line_bufferxreallocps2_promptrl_reset_terminalEOF_Reachedcurrent_historyrl_variable_dumper_rl_erase_at_end_of_line_rl_prev_macro_keyrl_noninc_forward_search_again_rl_insert_typeinsv_terminalmake_new_array_variablesourcenestrl_backward_kill_lineword_token_alistcheck_identifierhistory_multiline_entriesmake_until_commandcommand_connectbash_add_historyget_current_flagsttfd_noecho_rl_output_character_functionrl_backward_wordthe_printed_command_sizeunquoted_glob_pattern_preset_shopt_optionspush_var_contextmake_cond_commandsccs_versionsh_syntaxtabrl_vi_overstrike_deleterl_newlineprog_completesprogramming_errorrl_deletesave_pipestatus_arraysubstringjob_exit_signalnew_var_contexthash_stringfind_in_path_rl_prep_non_filename_textunlink_fifo_listhistory_offsetrl_vi_fwordhistory_lines_this_sessionsh_physpathrl_vi_matchjob_exit_statusprogcomp_removesh_mktmpfdsource_searches_cwdrl_refresh_lineset_job_controlget_word_from_stringrl_tty_unset_default_bindingsprint_var_valuemap_overrl_insert_commentline_number_for_err_trapset_sigchld_handlerreinit_special_variablesfc_execute_fileunbind_function_defrl_insertlogout_builtinprint_shift_errorfifos_pendingps0_promptcopy_fifo_listexport_builtinopen_buffered_streamrl_noninc_reverse_search_again_rl_nsearch_callbackrl_vi_redo_rl_arg_overflowrl_execute_nexthup_on_exitcoproc_listreset_signal_handlersit_userspush_argsstrvec_mcreateinitialize_shell_variablesset_impossible_sigchld_trapskipsubscripttempenv_assign_error_rl_is_mbchar_matchedecho_doc_rl_arg_callbackphash_flusharray_from_word_listrl_reverse_search_historyarray_copywait_docextract_arithmetic_substxmallocyy_input_name_rl_find_next_mbcharkill_current_pipelineeval_builtindircomplete_spellingu32toutf16_rl_find_prev_mbchardiscard_pipelinerl_skip_csi_sequence_rl_dispatchrl_vi_yank_tofind_variable_nameref_for_create_rl_revert_all_linesconvert_var_to_assochist_verifyinternal_wstrmatch_rl_term_eifind_variable_no_invisiblemaybe_execute_filerl_vi_goto_markstrvec_strcmprestart_job_controlconf_standard_pathfilter_stringlistrl_vi_delete_tocompspec_copycompgen_doc_rl_term_pcmakunboundphash_searchrl_insert_close_rl_set_the_linethis_shell_functionrl_vi_prev_wordhistory_expansion_inhibitedrl_yankarray_removerl_basic_quote_charactersminus_o_option_valuesync_buffered_streampwd_builtin_rl_find_prev_mbchar_internalabsolute_programrl_vi_change_case_rl_vi_domove_callbackprogcomp_disposerl_re_read_init_filettfd_onecharrun_trap_cleanupget_group_arrayrl_erase_empty_linedecode_prompt_stringmail_warningrl_kill_textifs_is_nullarith_for_docxtrace_inithistory_getstatic_shell_builtinsset_current_prompt_levelmake_bare_simple_commandsh_double_quotesubshell_argvzresetcurrent_readline_line_indexeof_encounteredumatchlen_rl_input_queuedrl_macro_dumperassoc_quote_escapesrl_startup_hookdot_doc_rl_sigcleanupread_but_dont_executerl_vi_replacephash_createrl_linefuncsource_filehash_sizeloop_levelcdable_varsprivileged_mode_rl_read_mbcharifs_valuerl_endmaybe_set_debug_trapbuiltin_usage_rl_output_some_charscheck_signals_and_trapsrl_redisplay_function_rl_control_keypad_rl_vi_ins_modestr_lenexecutable_fileexpand_assignment_string_to_stringbind_var_to_intshell_name_rl_keyseq_cxt_disposeremove_aliasset_directory_hookrl_vi_searchall_array_variablesgive_terminal_tojust_one_command_rl_argcxttrap_saved_exit_valuearray_create_element_rl_walphabeticwait_for_any_job_rl_null_functioncommand_errorallow_null_glob_expansion_rl_insert_chartrue_docgetcoprocbypidassign_array_var_from_word_listmake_new_assoc_variablerl_visible_statsrl_list_funmap_names_rl_vi_ins_mode_strdebugging_login_shellget_new_window_sizesh_mktmpfppipefail_optrl_completion_modewith_input_from_stdin_rl_allow_pathname_alphabetic_charspush_tokenbuiltin_builtinwant_pending_commandrl_free_keymaprl_completion_mark_symlink_dirsps1_prompt_rl_with_macro_inputinterrupt_statesigterm_sighandlerrl_menu_completion_entry_functionreturn_builtin_rl_possible_meta_prefixesrestore_funcarray_statedisplay_signal_listxtrace_fdcopy_word_liststring_list_internalrl_copy_keymaprl_kill_linerl_already_promptedcompspec_createttsaveredirection_errorrl_expand_promptrestore_pgrp_pipeset_var_attributecomplete_docread_docfunmap_program_specific_entry_startrl_change_environmentrl_vi_arg_digitrl_add_defundispose_variablevariable_contextrl_maybe_unsave_linerl_transpose_wordsrun_sigchld_trap_hs_replace_history_datarl_completion_word_break_hookrl_undo_commandstrlist_createcoproc_wclose__data_startstrlist_to_word_listrl_vi_overstrikemake_group_commandset_minus_o_optionexecute_shell_functionwait_signal_receivedrl_library_version_rl_term_iprl_overwrite_modeset_bash_input_fd_rl_vi_motion_commandhash_walkclear_hostname_listwait_builtinrl_terminal_name_rl_vi_domove_motion_cleanupset_buffered_streamstrvec_to_word_listrl_call_last_kbd_macrorun_unwind_framedispose_command_rl_vi_cmd_mode_strclear_fifointernal_strmatchrl_extend_line_bufferextract_colon_unitpromptvarscompspec_disposestrlist_walkkill_doc_rl_caught_signalsh_notbuiltinplace_keywords_in_env_rl_top_levelhistory_word_delimitersexpand_string_assignmentrl_backward_byterl_messagerl_read_keyassoc_quoterl_set_signalsdo_redirectionsrl_clear_historysh_invalidoptnametilde_expansion_preexpansion_hooksh_set_lines_and_columns_rl_enable_keypadextract_command_subst_rl_completion_prefix_display_lengthdisallow_filename_globbinginitialize_job_signalsrl_completer_word_break_charactersrl_unix_word_ruboutprint_timevalcolon_doctimeval_to_cpurl_vi_append_moderl_pending_signalexec_argv0rl_completion_typeit_hostnamescoproc_initset_pipestatus_from_exitmatch_pattern_wchar_rl_overwrite_charkill_pidtest_builtinhist_last_line_addedrl_tab_insert_rl_update_finalfree_pushed_string_inputadjust_shell_levelupdate_export_env_inplacesv_ifspop_dollar_vars_rl_term_DCmaybe_set_return_trapxtrace_setrl_make_keymapcoproc_closeallfunction_trace_moderl_transpose_charsrl_executing_keyseqsh_opterr_rl_scxt_dispose_rl_print_color_indicatorit_commandsxparse_dolparenrestore_original_signalssh_coproc_rl_colored_completion_prefixbrace_expansionexpand_wordsrl_vi_substsub_append_stringttgetattrhistory_file_versionrl_menu_completeansicstrunbind_namerefquote_globbing_charsrl_yank_popinit_yy_iodo_assignmentreset_mail_fileszreadcshopt_docdump_po_stringsrunning_in_backgroundshift_docrl_reset_screen_sizeparse_and_execute_cleanuprl_char_is_quoted_ptilde_expansion_failure_hooksubshell_exitzreadcopy_history_entrygetmaxgroupsreset_terminating_signals_rl_echoing_prl_bracketed_paste_beginword_list_remove_quoted_nullsposix_initializefind_variable_last_namerefbind_docenable_docrl_named_functioncompopt_builtinset_original_signalglob_dirscantilde_additional_prefixesbash_history_disable_rl_any_typeinsubshell_environmentprintf_dochistory_search_prefixdispose_fd_bitmapwithout_job_controlinternal_informget_array_valuestrip_trailing_ifs_whitespacerl_backward_char_rl_pop_executing_macromaybe_call_trap_handlershell_start_timeprompt_string_pointertypeset_docrl_vi_yank_argexec_builtinforced_interactivemalloc_trace_at_exitphash_insertsource_uses_pathindirection_level_stringlist_all_jobsenable_builtin_IO_stdin_used_rl_copy_undo_liststrvec_len_rl_ttyflushstream_listrl_readline_statesh_un_double_quote_rl_color_indicatorrl_freerl_do_lowercase_versionalrmbufasynchronous_notificationdelete_all_contextsset_locale_varpatch_levelrl_do_undosignal_namemake_funcname_visibleabsolute_pathnameappend_processemacs_meta_keymapget_all_original_signalslast_asynchronous_pidpcomp_curtxtassoc_to_word_listyychargetopts_docit_aliasesrl_restart_outputarray_variable_namelocal_docprint_array_assignmentrl_pre_input_hookhistory_search_delimiter_charscoproc_pidchkset_dollar_vars_unchangedrl_history_substr_search_forwardsh_single_quoterl_undo_listsh_validfd_rl_term_backspacestring_to_rlimtyperl_discard_argumentstrvec_mresize_rl_init_eightbithistory_lengthcommand_substituterl_display_fixedmaybe_make_restrictedfunction_doc_rl_get_screen_size_rl_sigcleanargerr_unboundvarit_directoriessh_badjobreset_completer_word_break_charsrl_filename_quoting_functionarray_quote_escapesunbind_argscoproc_closelist_rest_of_args_rl_utf8localebash_directory_completion_matchesexpand_arith_stringrl_get_previous_historyhistory_searchrl_translate_keyseqcurrent_readline_promptliteral_historystrsubinteractive_shellwhile_doceof_encountered_limitclean_simple_commandarith_docrl_backward_char_searchsh_closepipe_rl_colored_statsarray_assign_listerrexit_flagsh_invalididrl_inhibit_completioncheck_hashed_filenamessh_exitstrlist_appendsys_errordispose_redirectsrl_set_promptprogrammable_completions_rl_history_preserve_pointmake_command_stringrl_vi_fetch_historyunfreeze_jobs_listifs_firstcharsuspend_doc_rl_optimize_typeaheaddispose_word_descassoc_replacesave_parser_statemake_absolutecurrent_prompt_stringarray_walkrl_key_sequence_lengthmake_arith_for_commandrl_upcase_wordread_tty_modifiedrl_history_search_forwardgetmaxchild_rl_completion_case_mapbash_tilde_find_wordsh_badpidrl_bind_keyseq_if_unbound_in_map_rl_completion_case_foldstrvec_copy_hs_append_history_linesh_getoptarray_to_word_listsh_mbsnlenassoc_flushcase_docfsleeptrap_to_sighandlerrl_callback_handler_removemapfile_builtin_rl_overwrite_ruboutget_variable_valuedump_translatable_stringswait_sigint_cleanupuinttostransiexpandsignal_in_progressrl_end_kbd_macrodispose_wordsrl_instreamget_shopt_optionshistory_search_poscompgen_builtinassoc_removetimeval_to_secsdollar_dollar_pidrl_dump_macrosget_dollar_var_valuerl_end_of_linerl_vi_insert_modeno_line_editingrl_vi_search_againcurrent_tokenbinary_testassoc_keys_to_word_listset_default_langrl_persistent_signal_handlers__libc_csu_initreadline_internal_charneed_here_docfind_variable_notempenvinternal_errorparser_save_aliasjobs_builtinfile_isdirrun_pending_trapsrl_vi_tilde_expandifs_firstc_len_rl_keyseq_cxt_alloccompopt_docfull_pathnamesetup_ignore_patternsrl_clear_visible_linelist_one_jobrl_bind_key_in_maprl_prefer_env_winsizetype_builtin_rl_to_lowermatch_ignore_casepop_scopeansic_wshouldquote_rl_print_prefix_colormaybe_append_historybash_re_editassoc_disposeshow_all_var_attributesrl_vi_eof_maybe_rl_strindexrl_add_funmap_entrymake_default_mailpathhistory_no_expand_charsdelete_all_jobscurrent_command_subst_pid_rl_screencharshave_unwind_protectssigalrm_seennum_fifosit_disabledrl_vi_insert_begsh_invalidoptget_string_value_rl_adjust_pointeval_docbash_history_reinitget_original_signalrl_vi_yank_popdisown_docrl_start_kbd_macrostrvec_createexec_docget_exitstatrl_quoted_insertrl_ignore_completion_duplicates_rl_doing_an_undosave_input_line_staterl_delete_horizontal_spaceinit_job_statsmark_modified_varshistory_reeditingreadline_internal_setupvalid_array_referencecurrent_userfalse_builtincdspellingstring_list_pos_paramsall_exported_variablesput_command_name_into_envrl_vi_editing_mode_rl_term_cr_rl_digit_psh_invalidsigsetup_history_ignorerl_markarray_insert_rl_vi_set_lastttnoechobind_builtincurrent_command_numberdirs_builtinfalse_docenable_history_listarray_keys_to_word_listit_builtinscommand_execution_stringset_or_show_attributesrl_ignore_some_completions_functionbind_variable_valueassoc_remove_quoted_nulls_rl_bell_preferencehistory_total_bytesrl_vi_bWordrl_donecurrent_builtincond_expand_wordrun_return_trapposixly_correctdelete_varrl_capitalize_wordglobal_variables_rl_set_cursorit_functionsfind_global_variablereport_error_rl_term_ICrl_delete_textsh_openpipexstrmatchprint_func_listrl_modifyingcheck_bash_inputunwind_protect_tag_on_stackarray_dequote_rl_in_streamremove_quoted_escapesmake_select_command_rl_complete_mark_symlink_dirsrl_crlfsigwinch_receivedttattrset_ppid_rl_arg_init_rl_ttymsgtime_to_check_mailxpg_echoxtrace_print_word_listfile_iswdirerror_trace_modeit_servicestrap_listrl_stuff_charlist_running_jobslet_builtintype_docexport_docrl_pending_inputsh_neednumargexec_redirection_undo_listprogcomp_searchprintable_filenamesv_history_controlrl_completion_invoking_keysh_getopt_dispose_istaterl_yank_nth_argglobal_command_rl_release_sigintwlcacheassoc_to_stringjobs_m_flagpop_streamit_signalssh_get_home_dirrl_redisplayrl_vi_change_charrl_untranslate_keyseqwcsmatchcmd_initshow_func_attributescoproc_checkfdrl_username_completion_functionstrvec_sortmk_msgstr_rl_pushed_input_available_rl_meta_flagttonecharfind_aliasalias_expandzreadretryrl_on_new_linerl_print_last_kbd_macro_rl_term_gotorl_vi_fWordpath_dot_or_dotdotbind_array_variableulimit_docrl_character_lenrl_unbind_function_in_mapreset_internal_getoptremember_on_historyglob_error_returnprogcomp_flushsh_makepathrl_exchange_point_and_markprogcomp_insertrl_vi_change_todispose_saved_dollar_varsinitialize_job_controlhistory_quotes_inhibit_expansionrl_cleanup_after_signalautocd_rl_complete_show_all_rl_redisplay_after_sigwinchrl_completion_entry_functionrestore_pipelineit_variablescolon_builtinrl_function_dumpererr_readonlyrl_set_keymap_from_edit_modextrace_print_assignmentrl_get_next_history_rl_enable_meta_keyfc_builtininteractive_commentsrl_on_new_line_with_promptxtrace_fdchkrl_readline_namerun_interrupt_trapmake_simple_commandrl_vi_unix_word_ruboutfile_status_rl_compare_chars_rl_revert_all_at_newlinefind_variable_namereflist_reverserl_editing_modesv_xtracefdrl_visible_prompt_length_rl_emacs_modestr_lenstring_quote_removalbash_licenserl_attempted_completion_over_rl_complete_mark_directoriesnohup_all_jobsreading_shell_scriptperform_hostname_completionrl_dump_variablesclear_unwind_protect_listjump_to_top_level_rl_convert_meta_chars_to_asciiany_signals_trappedrl_initializextrace_print_for_command_headterminate_current_pipelineset_tty_statecomsub_ignore_returnrl_unbind_command_in_map__bss_startxtrace_print_arith_cmdu32tocharxtrace_print_select_command_headunalias_docrl_forwardarray_variable_partfind_global_variable_noref_rl_block_sigwinchrl_tty_set_echoingno_invisible_vars_rl_complete_show_unmodifiedsetup_async_signalsshow_shell_versionfuncnest_maxstream_on_stackset_current_flagstilde_initializeit_enabledbg_builtinhistory_numberpre_process_linerl_dingreadonly_doc_rl_menu_complete_prefix_firstrl_backwardlist_optarginitialize_trapshistory_set_poscopy_redirectssv_histcharsumask_builtinmake_pattern_listshopt_builtinno_optionstteightbitbuiltin_ignoring_errexitlist_optoptdelete_all_aliases_rl_init_line_stateif_doctest_bracket_docrestore_parser_statereturn_catch_flagclose_pgrp_pipemake_array_variable_valuesh_getopt_alloc_istatecommand_oriented_historyget_current_user_inforeap_dead_jobsrl_executing_macrosave_token_statepcomp_set_readline_variablespwd_docsh_mktmpname_rl_find_completion_wordbegin_unwind_framestrlist_removerelease_statussv_histsizeisnetconnsplit_at_delimsarray_createmake_builtin_argvset_var_read_onlyarray_unshift_elementinitialize_bashoptsrl_restore_prompt_rl_emacs_mode_strhistory_lines_written_to_fileexecute_command_internalterminating_signaltime_docgetcoprocbynameinitialize_bash_inputumask_docrl_get_keymap_namemake_subshell_commandcd_docrl_pointrl_clear_message_rl_screenheightclose_new_fifosu32toutf8strlist_prefix_suffix_rl_history_saved_pointsv_globignorefind_reserved_wordsv_tzfind_token_in_alistlast_history_line_rl_term_dcparse_and_executeprint_var_list_rl_dispatch_subseq_rl_qsort_string_compare_rl_screenwidthreadarray_docrl_make_bare_keymapansic_quotearray_to_argvread_from_stdinrl_prep_term_functiongnu_error_formatsh_chkwritemaybe_save_shell_historystrvec_flushhistory_comment_charttsetattrmake_here_document_rl_signal_handlercoproc_disposerl_save_statehistory_doc_rl_disable_tty_signalsxtrace_print_cond_termget_current_optionshashing_enabled_rl_vi_initialize_linettfd_nocanon_rl_vi_redoingrl_variable_valueclear_fifo_listrl_completion_found_quoteparser_remaining_inputsave_pgrp_pipedont_save_function_defscheck_signals_rl_abort_internalbuiltin_address_internalcoproc_rclosecheck_selfreffc_doc_rl_get_char_lenignore_signalshift_builtinstrvec_resizerl_invoking_keyseqsrl_filename_quote_charactersget_random_numberbash_history_enablemake_case_commandnameref_invalid_valuerl_arrow_keysevalexparray_keys_rl_vis_botlinpolite_directory_formatdirs_docrl_set_keyboard_input_timeoutdeclare_builtinexecutingfd_is_bash_inputcopy_redirectfree_trap_stringsvalid_nameref_value_rl_enable_bracketed_paste_rl_search_getcharinvalidate_cached_quoted_dollar_atset_signal_hard_ignoredrl_prep_terminalecho_input_at_readmove_to_high_fdstrlist_disposemake_arith_command_rl_page_completions_rl_completion_columnsnoglob_dot_filenamessetifsstupidly_hack_special_variablesshell_function_defs_rl_isearch_callbackshow_var_attributes_rl_reset_argumentmatch_pattern_charclear_shell_input_linethis_shell_builtinload_historycheck_add_historycontinuingrl_redraw_prompt_last_linestdin_redirectsfg_builtinprint_assoc_assignmentsubst_assign_varlist_rl_possible_control_prefixestermsig_handlerforce_fignoreexit_shellsh_badoptsv_hostfilerl_vi_next_wordarray_to_stringindirection_levelrl_vi_rubouthash_bucketlast_command_subst_pidstrlist_sortsave_pipelinelast_shell_builtinmbstrlen_rl_lowercase_pit_exports_rl_disable_meta_keyrl_event_hookcontinue_doc_rl_vi_last_commandrl_get_keymap_by_nameparse_and_execute_levelstrip_trailinginitialize_itemlistextended_quote_rl_put_indicatoris_directory_rl_char_valueloptenddispose_used_env_varsrl_char_searchmapfile_docassoc_dequotevar_attribute_stringcopy_wordtest_unoprl_beg_of_line_rl_term_clrpagstrvec_removeparser_expanding_aliasarray_needs_makingit_filesparse_commandterminal_pgrpcheck_binary_filerl_vi_undo_rl_replace_textrun_unwind_protectsrl_clear_signalslegal_number_rl_pure_alphabeticsh_setlinebufmake_word_from_tokenit_stoppedreset_parserhistory_subst_charbrace_expandchar_is_quotedlocaleexpand_rl_saved_line_for_historyfrom_return_trapprintf_builtinforce_append_historyunset_sigwinch_handlerremember_argssigterm_received_rl_callback_data_disposeset_bashoptsprogcomp_createprint_cond_commandexpand_compound_array_assignmentrl_vi_first_printtt_seteightbitrl_replace_linecoproc_docset_current_optionssh_wrerrorinit_mail_datesrun_exit_traprl_kill_full_linegetopts_builtindispose_wordtest_binopsh_contains_shell_metasrl_directory_rewrite_hooktop_level_cleanuprl_vi_deletedispose_var_contextcurrent_host_namedispose_cond_node_rl_reset_promptrl_executing_keymapthis_command_namerl_catch_sigwinchrl_vi_append_eol_rl_term_clreolrl_rubout_or_deletelocale_utf8localecoproc_unsetvarssh_restrictedrl_vi_back_to_indenthere_doc_first_linemake_word_flagsend_job_controlrl_vi_insertion_modeunbind_array_element_rl_echo_control_charsbashline_set_event_hook_rl_rubout_charassoc_modcasesignal_is_hard_ignoredset_itemlist_dirtystrlist_from_word_listit_groupsread_builtinget_directory_stackrl_arg_signlist_opttypedecode_signalnoclobberuser_command_matchesassign_array_var_from_stringhistory_get_timeyylvalmitosinput_availdo_assignment_no_expandrl_filename_stat_hookchkexport_rl_color_ext_listsubshell_argcexpand_string_unsplituwp_initbash_brace_completionhistory_arg_extractsv_localerl_abortset_dirstack_element_rl_restore_tty_signalszsyncfdrunning_under_emacspushd_docbind_global_variableall_variables_matching_prefixsh_optarg_getenvit_setoptsrl_possible_completionsmbsmbchar_rl_errmsgwait_intr_buftvlist_indrl_filename_dequoting_function_rl_keyseq_timeoutevalstringrl_filename_completion_desirederr_badarraysubexecute_commandbash_delete_last_historysame_filetest_docmake_local_variableassign_compound_array_listcheck_jobs_at_exit_rl_move_vertread_octalpidstat_tabledelete_all_variables_rl_quit_charassigning_in_environmentrl_dispatchingunclosed_pairunalias_builtinprogcomp_walkset_langrl_insert_completionsttcbreakget_job_specskip_to_histexpthrow_to_top_levelsetup_exec_ignoredescribe_commandassoc_referenceextract_array_assignment_listrl_end_of_historysourcelevelsource_docmake_redirectionsort_variablessh_mkdoublequotedrl_explicit_argget_job_by_piddifftimevalstrvec_dispose_rl_callback_data_allocset_dollar_vars_changedhangup_all_jobsfind_flagexecuting_listshould_suppress_forkignore_tty_job_signalsuconvertevalnestverbose_flagglob_char_ppush_dollar_varsunbound_vars_is_errorrl_beginning_of_historysh_unset_nodelay_modecheck_window_sizeremove_historybash_clear_historypipeline_pgrpother_token_alistrl_readline_versionbash_input_fd_changedinitialize_aliasesprint_var_functionexecuting_command_builtinbash_readline_initializedsh_needarghist_last_line_pushedhave_devfdunset_docpushd_builtinsv_ignoreeofrl_bind_key_if_unboundmake_for_commandhistory_tokenizefile_errorrl_copy_region_to_killget_alias_valuerl_dump_functionsno_argsde_backslashrl_vi_char_searchoriginal_pgrpxtrace_print_case_command_headinitialize_flagsrl_restore_staterl_line_buffer_lenhistory_expandecho_command_at_execute_rl_vi_done_insertinglist_length_rl_bind_stty_charsvi_movement_keymaprl_unbind_key_rl_kscxtalias_expand_allrl_deprep_term_functionremove_unwind_protectarray_flushnumber_of_argsexpanding_redirdelete_jobrl_save_promptemacs_ctlx_keymaprl_get_keymap_rl_copy_undo_entrytrap_builtinhelp_builtinget_job_by_namerl_bind_key_if_unbound_in_mapsh_ttyerrorunstifle_historyoptflagscommand_doc_rl_set_mark_at_posdebugging_modebash_servicename_completion_functionrl_kill_wordtilde_additional_suffixesbashline_reset_event_hookrl_copy_forward_wordrl_push_macro_input_rl_free_saved_history_line_rl_arg_dispatchrestore_input_line_statethe_current_maintainerrl_bind_keyseq_in_maprl_end_undo_grouprun_error_trapget_hostname_listextended_globsv_pathcoproc_allocprint_simple_commandrestore_token_statemake_cond_nodeansic_shouldquotemake_word_listspnameget_tty_stateconditional_doclegal_identifierrl_callback_read_charvariable_help_docstop_making_childrenrl_backward_menu_completewait_fornew_fd_bitmaprl_catch_signalsthe_current_working_directorystop_pipelinestart_pipelineassoc_subrangesv_histignorehistory_expansion_char_rl_vi_textmod_commandextract_process_substfd_to_buffered_streamrl_delete_or_show_completionsmaybe_add_historyit_shoptslast_command_exit_valuearray_slicehistory_write_timestampsall_shell_variablesrl_downcase_wordcheck_unbind_variablesh_canonpathrl_invoking_keyseqs_in_mapgetopts_resetexecutable_or_directoryhistory_builtin_rl_enable_metashell_pgrpparse_string_to_word_listget_group_listrl_display_match_listfind_functionstrlist_mergebash_dequote_textrl_noninc_reverse_searchunary_testrl_numeric_arghistory_delimiting_charsarray_subrangeall_visible_variables_rl_reset_completion_state_rl_term_upcoproc_fdcloserl_maybe_save_linerl_copy_textinherit_errexitrl_universal_argumentsh_getopt_restore_istateprog_completion_enabledrl_get_keymap_name_from_edit_mode_rl_forward_char_internalpcomp_set_compspec_options_rl_term_iccomplete_fullquote_rl_iscxt_rl_out_streamrl_basic_word_break_characters_rl_dispatch_callbackprogcomp_sizemake_childstartup_staterl_vi_set_markbash_groupname_completion_function_rl_savestringstrlist_copysh_notfoundzreadcintrall_shell_functionsreset_shell_flagsreplace_history_entry_rl_term_immake_local_assoc_variablecoproc_reapdefault_tty_job_signals_rl_enable_paren_matchingshell_execvestart_jobsignal_is_ignoredrl_insert_modexmbsrtowcsnum_shell_builtinscd_builtinpopd_builtintt_setnoechoglobal_error_listwith_input_from_buffered_streamstdin_redirrl_maybe_replace_linerl_completion_suppress_appendttfd_eightbitwait_for_single_pidfree_buffered_streamsh_invalidnumhistory_lines_read_from_file_rl_vi_reset_lastifs_is_setinitialize_terminating_signalsassign_in_envhistory_basedist_versionbind_assoc_variablemap_over_funcsconnect_async_listsh_readonlymerge_temporary_envextglob_pattern_pfnx_fromfsbash_delete_histentzreadnfind_variable_nameref_for_assignmentit_bindingssh_getopt_restore_stateunlink_fifo_rl_match_hidden_files_rl_callback_funcrestore_default_signalbash_default_completionrl_stop_outputparser_restore_aliasrestore_pipestatus_arrayrl_resize_terminal_rl_clear_to_eolvi_insertion_keymapexpand_aliasesadd_alias_rl_isearch_terminatorskill_builtinrl_set_paren_blink_timeoutline_number_basedispose_exec_redirectsdequote_stringshopt_listoptdiscard_unwind_frame_rl_undo_group_level_rl_mark_modified_linesrl_history_substr_search_backwardGLIBC_2.2.5NCURSES_TINFO_5.0.19991023GLIBC_2.11GLIBC_2.14GLIBC_2.8GLIBC_2.15GLIBC_2.4GLIBC_2.3.4GLIBC_2.3       ui T Ŧ` { ii ii ti ii ui T=0 =0=0 =0( =0( =0( =0) =0 ) >0 1>01(>018>01H>0w0X>0 1h>0 1x>0 1>01>0 1>0 1>01>0 1>0 1>0 1>0v0?01?0 1(?0w08?0 1H?0 1X?0 1p?0= x?0< ?0= ?0< ?0< ?0> ?0HH ?0H ?0 N ?00R ?0S ?0HW @00\ @0p^ @0Pb 0@0e @@0i P@0t `@0px p@0hy @0{ @0{ @00} @0~ @0 @0 @0 @0 A0 A0 A08 0A0 @A0 PA0H `A0ؗ pA0 A0С A0 A0 A0ذ A0( A0( A0س A0 B0H B0X B0ػ 0B0 @B0H PB0 `B0 pB0 B0 B0 B0 B0 B00 B0p B0 B0P C0 C0` C0 0C08 @C00PC0`C0XpC0 C0x C08C0C0C0@C0C00C00D0D0p D0x0D0P@D0&PD00'pD0HxD0&HD0-HD0;HD0BHD0HD0&HD0VHE0fHE0;H0E0xH8E0;HPE0HpE0HxE0HE0HE0HE0HE0HE0;HE0HE0HF0H0F0H8F0;HPF0 IF0OF0PF0PF0%PF0PF0PF0/PF07P G020G0XP@G0hPPG0=`G0HpG0<G0>G0c6G0EG05<G0EG0pPG0rB G0PH0_8H0E H0zP0H0P@H0PPH05`H0PpH0PH0QH0( H0jH0h[H0t[H0z[H0[H0[H0uH0[I0[I0wI0[I0'A I0[(I0C 0I0[@I0R^PI0:\`I0|pI0|I0|I0|I0|I0|I0|I0|I0|J0zJ0r J0@ (J0s 0J0z@J0p HJ0(XJ0p `J0zpJ0@p xJ0vJ00v J0zJ0 J0zJ0q J0zJ0 J0zJ0 J0zK0p K0{K0P K0"{0K0 `K0'zhK0t pK0~xK0r K0[ K0v K0~K0 K0{K0NzK0{K0~K0~L0dL0`>1L0tL0x1 L0$ (L010L0w8L0Ȑ1@L0wHL01PL0zXL01`L0}hL01pL0xL0X1L0wPL0ؐ1L0L01L0L0X>1L0L0h>1L0L0P>1L0L0>1L0wL0x>1L0L0p>1M0M0>1M0M0>1 M0I(M0>10M08M0>1@M0D HM01PM0XM0>1`M0hM0>1pM0HxM0P1M0M0`1M0PM0А1M0M0>1M0M0H>1M0']M0@>1M0M0 M08M07uN0N0 N0N0 N0(N0"0N0%8N0I@N0(HN0 PN0CXN0w`N0+hN0.pN0 xxN0) N01N04N07N0wN0JN00N0 N00O0 O0@1 O0 0O0@1@O0_7PO0t0`O0txO0hp0O0 O0x0O0 O00O0 O00O0 O00P0 P00 P0 8P0hp0@P0z8PP0 1`P0KpP0 1P0rP0|0P0DP0DQ0 (Q0R 0Q0S 8Q02K`Q0DQ0DQ0DQ0DR0AC R0($1R00R (R0# 8R00@R0Q PR0 E`R0w0xR0ER0&ER0.ER08ES0?E@S0FEPS0h1hS0LES0SES0[ES0bET0kET0 10T0 @T00HT0pQ XT0tET0KT0@ T0R T0S T0E U0I(U0$08U0I@U01PU0IXU0<'1hU0IpU0&1U0JU0(0U0 JU0H1U0JU0{0U0!JU0(1U0 U0*JU0(1U0 U03JV0(1V0 V0 [0,s[0 [0;s[0q [0Gs[0 [0_s[0} \0|s\0n \0s\00p \0s(\0 0\0#w8\00q @\0sH\0 P\0sX\0 `\0Xxh\0` p\0xx\0` \0s\0P \0s\0c \0s\0. \0q\0@. \0t\01 \0sA \0- \0Bt\0g \0t\0m ]01t]0 ]0x]0 ]0x(]0 0]0x8]0  @]0(yH]0` P]0>tX]0c `]0Pth]0Б p]0_tx]0c ]0tt]0Џ ]0t]0> ]0t]0v ]0t]0@ ]0t]0t ]0t]0 ]0t]09 ]0t]0@{ ^0w^0` ^0t^00u ^0u(^0= 0^0u8^0w @^0xH^0 P^0*uX^0 `^0:uh^0` p^0Jux^0 ^0Uu^0P: ^0Zu^0` ^0mu^0 0 ^0u^01 ^0#x^0. ^0u^00 ^0u^0( ^0u^0+ _0u_02 _0Cx_0@) _0u(_0 0_0u8_0 @_0uH_0 P_0uX_00 `_0uh_0p p_0vx_0 _0!v_0p _0*v_0 _03v_0 _0Bv_0 _0Qv_0P _0^v_0 _0mv_00 _0wv_0 `0v`0P `0v`0 `0v(`0P 0`0v8`0P @`0vH`0P P`0vX`0 ``0vh`00 p`0vx`0 `0v`0` `0v`0 `0v`0 `0 w`0` `0 w`0P `00w`0P `09w`0  `0Fw`0p a0Twa0 a0fwa0P a0ow(a0 0a0w8a0 @a0wHa00 Pa0wXa0 `a0wha0 pa0wxa0@ a0wa0 a0wa0 a0wa0 a0wa0 a0wa0 a0wa0 a0xa0 a0xa0 b0 xb0 b04xb0 b0@x(b0* 0b0Lx8b0 `b0 hb00pb0pzxb00b0|b00b0|b0`0b0@ b0@0b0|b0@0b0|b0@0b0|b0 0c05{c0ԡ0c0L{ c0?10c0|8c0?1Hc0|Pc0X01`c0}hc0\01xc0@ c0l01c0%}c0h01c09}c0ء0c0F}c01c0Y}c0С0c0q}c0,1d0}d0p1 d0}(d0P08d0}@d0(01Pd0}Xd0?1hd0}pd0-1d0@ d0,1d0}d00d0}d0,1d0~d0p01d0!~d00d04~e0P01e0Q~e0,1(e0[~0e0,1@e0g~He00Xe0a{`e00pe0xe01e0x~e0,1e0~e0x01e0~e0t01e0u{e0,1e0~e0T01f0~f0`01o0 o0 o0 0o0@ 8o0} @o0@s Ho0^ Po0p`o0( po0P xo0P o0. o0w o00o0w o0  o0 o00o0 o0o0p0p0hp0 p0yp0 p0 p0 p0 p0 p0 p0 q0 q0 q0 0q0 @q0 Pq0 `q0 pq0\C q0 q0 q0# q0 q0 q0Iq0# q0U5r0 r0/ r0} 0r0. @r0v. Pr0~r0'zr0V r0[ r0` r0 r0=vr0L r0 s0 s0 s0 0s0w@s0Q Ps0w`s0Eps0Hs0# s0U5s0r[s0 s05s0 s0 s0 `t0# ht0Юpt0# xt0Эt0o$ t0`t0"$ t0pt0y$ t0Мt0# t0t0Y$ t0t0# t0t0$ t0t0# t0u0$ u0u0# u0Ь u0$ (u00u0 " 8u0@u0# Hu0Pu0$ Xu0`u0$ hu0pu0$ xu0u0$ u0u0$ u0u0$ u0u0$ u0u0$ u0u0F# u0u0$ u0u0u" u0v0! v0@v07v0 v0 (v00v06 8v0г@v0$ Hv0гPv0$ Xv0г`v0% hv0pv0 % xv0v0 v0v0% v0`v0# v0w0Pw05 w05 w05 w05 w05 w05 w05 w05 x05 x05 x05 x05 x05 (x05 0x06 8x0 6 @x06 Hx06 Px0%6 Xx0-6 `x056 hx0=6 px0E6 xx0M6 x0T6 x0\6 x0d6 x0n6 x0v6 x06 x06 x06 x06 x06 x06 x06 x06 x06 x06 x06 y06 y06 y07 y0 7 y07 (y0#7 0y0/7 8y0;7 @y0G7 Hy0S7 Py0_7 Xy0k7 `y0w7 hy07 py07 xy07 y07 y07 y07 y07 y07 y07 y07 y07 y07 y08 y0x" y0 8 z0Y$ {0# |0 |0C `|0y$ |0F |0F h~0M~0@N~0@E(0Fh0E00N00C(0 Nh0E0B0L(0Lh0B0pA0@(0Eh0L0C00020@r0PD0 0H)00280@tH0@D0P02`0"7h0ux00D00h)0300|0 D0030!3ȇ00}؇0D00*30=00~0D00* 073(0~80C0@0>3P0IX0@h0C0p0L30i300C00m30D0Ȉ0C0Ј0D0w300C00w30|30Њ(0C000|3@0HH0X0C0`0(*p03x00C00P*0300pC00*Љ03؉00`C00*0K0P0PC0 0300380H0@C0P0*`0q h0px00C0030300 0 C0030]! Ȋ00؊0C00+0%K00C003 0=(080B0@03P0=X0@h0B0p0H+0 00B0030 0ȋ0B0Ћ0 40I000B00+0_70(0B0004@0AC H0 X0B0`0+p0Jx0 0B00,0740 0pB00P,Ќ0~r،0 0`B00,0v 0 0PB0 0>400P480P5 H0@B0P0,`0\h0P x00B00U4070p[ 0 B00@-0Dȍ0^ ؍0B00-0E0p 0B00- 0`4(0q 80A0@0-P0i4X0q h0A0p0o40y40@s 0A0040s( 0@s Ȏ0A0Ў040?F0`v 0A004040pw (0A0004@0΅H0pw X0A0`04p04x0x 0A0040 / 0z 0pA00.Џ0( ؏0 0`A004050Љ 0PA0 00.00580 H0@A0P0 5`0$5h0P x00A00)50 0 A00`.0  ؐ0A00.0 0A00. 0H80@0@0<5P0=vh0@0p0.0'z0@000/0 ȑ0@0Б0/0 0@00/0 (0@000/@0EX0@0`00p0O50@00W50 # 0p@00f5В0s50`@00}5050P@0 0500sH0@@0P080`05h0) x00@005050p. 0 @0050;Pȓ0% ؓ0@005050 0@00p0 06(0p 80?0@00P0zvX0 h0?0p00060 0?00h1060 Ȕ0?0Д02060  0?00(2060  (0?00020WЕ0W0W0W0W0W 0W00X@0XP0_`0$Xp00X0@X0_0LX0_0XXЖ0`0dX0@`0pX0|X 0X00X@0XP0X`0Xp0X0X0X0Y0Y0$YЗ04Y0DY0TY0`Y0pY 0|Y00Y@0YP0Y`0Yp0`0`0a08a0ha0aИ0a0a0@b0b0b 0Y00Y@0bP0Z`0Zp0,Z0c0HZ0 e0`Z0tZЙ0Z0Z0Z0Z0Z 0Z00Z@0[P0([`08cp0`c0c0c0d0Pd0dК0d0e0@e0e0e 0f00@f@0xfP0f`0fp00g0`g0@[0X[0[Л0[0[0[0[0[ 07$ 00[@0[P0[`0[p0[0[0~0[0[0[М0[0[0[0G?0 \ 0\00\@0\P0\`0\p0#\0'\0+\0/\03\06\Н0:\0>\0!" 0B\0F\ 0I\00@0M\P05 `0'A p0Q\0b\0q\0}\0\0\О0\0\0\0\0\ 0\00\@0\P0\`0\p0]0]0]0]0]0". П0]0]0 ]0%]0 0*]000]@06]P0?]`0;]p0E]0T]0`]0r]0]0]Р0]0]0]0]0] 0]00]@0^P0^`0$^p02^0>^0}0R^000p80@{ H0@{ X0@{ h00 x0@{ 0@{ 0@{ 0} 0 c Ȣ00w آ0@{ 0@{ 00w 0g 0@{ (0m 80@{ H0 X0 h0 x01 0v 0 0@{ 0( ȣ0@{ أ0 0@{ 0@{ 0@{ 0 (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȥ0@{ ؤ0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȥ0@{ إ0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȧ0@{ ئ0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȧ0@{ ا0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȩ0@{ ب0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȩ0@{ ة0@{ 0@{ 0@{ 0@{ 0} (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȫ0@{ ت0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȫ0@{ ث0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȭ0@{ ج0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȭ0@{ ح0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȯ0@{ خ0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȯ0@{ د0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ Ȱ0@{ ذ0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ ȱ0@{ ر0@{ 0@{ 0@{ 0@{ 0@{ 00 0 0 Ȳ0o 00w 0@. 0t 00w (0 H0Џ X0v h0 x0 0 01 0v 0 س0( 80 H00p x0P 0q 0P 0 0 0 0 0Џ (0 80 H0p X0 h0 x0 0 0 0 0 ȵ0 ص0 0 0 80 X0 h0 x0P 0 0 0 0 ض0p (0 H0@ h0 x0 0 09 0 ȷ0 ط0 0 (0 80 H0  X0 h0 x0P 0 0 0 ȸ0o ظ0 0 0Џ 00p 0 (0 H0@ h0 x0 0 0 0 ȹ0P ع0 00 (0 0 0@ 0P: 0 0= 0p> x0w 0w 0w 0w 0w 0w 0w 0w 0w 0w 0w (0w 80w H0w X0w h0w x0w 0w 0w 0w 0w 0w 0w 0w 0w 0w 0= X0- 0 0 - 0w (0P X0P 09 02 80 c X0 0` 0P 0 (0c X0 h0+ 0 0 0 0 0 0 0 0 0 0 H0 X0c h0 x0c 0w 0w 0w 0w 0w 0w 0w 0w 0w (0w 80w H0w X0w h0w x0w 0w 0w 0w 0w 0w 0w 0w 0w 0w 0w (0w H0~ x0+ 0q 0P 0- 00q H0@ h0 0 09 0` 00 0@) h0 x0 - 0` 0p 0o 0y 0q 00p 0 (0} 80 c H00w X0@. h0t x00w 0 0Џ 0v 0 0 0 01 0v 0. (0`080( X00x0 0P: 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0} 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ 0@{ (0@{ 80@{ H0@{ X0@{ h0@{ x0@{ 0@{ 0@{ 0! 0P# 0) 0'@ 0y0~0 021(021H0? p0Qx0\00000. 0hC 000ͅ0l0LH0ЅX0օh0x0܅0000܅0000(080 X0 o0(o0Xo0Who0_o0lo0o000000F0/0Xh0`h0hh0ph0xh0h0h0h0h0 h0 h0 h0 h0 h0h0h0h0h0h0h0h0i0i0i0i0 i0(i00i08i0@i0 Hi0!Pi0"Xi0#`i0$hi0%pi0&xi0'i0(i0)i0*i0+i0,i0-i0.i0/i00i01i02i03i04i05i06i07j08j09j0:j0; j0<(j0=0j0>8j0?@j0@Hj0APj0BXj0C`j0Dhj0Epj0Fxj0Gj0Hj0Ij0Jj0Kj0Lj0Mj0Nj0Oj0Pj0Qj0Rj0Sj0Tj0Uj0Vj0Xk0Yk0Zk0[k0\ k0](k0^0k0`8k0a@k0bHk0cPk0dXk0e`k0fhk0gpk0hxk0ik0jk0kk0mk0nk0ok0pk0qk0rk0sk0tk0uk0vk0wk0xk0yk0zl0{l0|l0}l0~ l0(l00l08l0@l0Hl0Pl0Xl0`l0hl0pl0xl0l0l0l0l0l0l0l0l0l0l0l0l0l0l0l0l0m0m0m0m0 m0(m00m08m0@m0Hm0Pm0Xm0`m0hm0pm0xm0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0m0n0n0n0n0 n0(n00n08n0@n0Hn0Pn0Xn0`n0hn0pn0xn0n0n0n0n0n0n0n0n0n0n0n0n0n0n0n0n0o0HHm-HtH5-%-@%-h% -h%-h%-h%-h%-h%-h%ک-hp%ҩ-h`%ʩ-h P%©-h @%-h 0%-h %-h %-h%-h%-h%-h%-h%z-h%r-h%j-h%b-h%Z-hp%R-h`%J-hP%B-h@%:-h0%2-h %*-h%"-h%-h%-h % -h!%-h"%-h#%-h$%-h%%-h&%ڨ-h'p%Ҩ-h(`%ʨ-h)P%¨-h*@%-h+0%-h, %-h-%-h.%-h/%-h0%-h1%-h2%z-h3%r-h4%j-h5%b-h6%Z-h7p%R-h8`%J-h9P%B-h:@%:-h;0%2-h< %*-h=%"-h>%-h?%-h@% -hA%-hB%-hC%-hD%-hE%-hF%ڧ-hGp%ҧ-hH`%ʧ-hIP%§-hJ@%-hK0%-hL %-hM%-hN%-hO%-hP%-hQ%-hR%z-hS%r-hT%j-hU%b-hV%Z-hWp%R-hX`%J-hYP%B-hZ@%:-h[0%2-h\ %*-h]%"-h^%-h_%-h`% -ha%-hb%-hc%-hd%-he%-hf%ڦ-hgp%Ҧ-hh`%ʦ-hiP%¦-hj@%-hk0%-hl %-hm%-hn%-ho%-hp%-hq%-hr%z-hs%r-ht%j-hu%b-hv%Z-hwp%R-hx`%J-hyP%B-hz@%:-h{0%2-h| %*-h}%"-h~%-h%-h% -h%-h%-h%-h%-h%-h%ڥ-hp%ҥ-h`%ʥ-hP%¥-h@%-h0%-h %-h%-h%-h%-h%-h%-h%z-h%r-h%j-h%b-h%Z-hp%R-h`%J-hP%B-h@%:-h0%2-h %*-h%"-h%-h%-h% -h%-h%-h%-h%-h%-h%ڤ-hp%Ҥ-h`%ʤ-hP%¤-h@%-h0%-h %-h%-h%-h%-h%-h%-h%z-h%r-h%j-h%b-h%Z-hp%R-h`%J-hP%B-h@%:-h0%2-h %*-h%"-h%-h%-h% -h%-h%-h%-h%-h%-h%ڣ-hp%ң-h`%ʣ-hP%£-h@%-h0%-h %-h%-h%-h%-h%-h%-h%z-h%r-h%j-h%z-f%-f%*-f1H=B.*.M*./*.5*.).*.u 1=A.@XS1HH|$H=M.xu;H|$1HHH|Ht$HH5, H\Ft%u/v.8v.~-v.H=+ 1ɉھGiH[AWAVIAUATAUSAHc1HD9A}I.uH=&.uJÃ=>.u >.u 1=.'.@H=q.=x>."a=j=J>.u C>.u 1=&.@= >.u >.u 1=&.@kH$dH3%(tH[HHH5f tHH=d 1Ht`(XATUHSH==.HtH[HK H:.Hr.%YAu@H= q.HtL%g:.1HLHH)LHHp.=?%.tuHCHH8vbH E1Hi E1H[]A\AUAT1USHH11HRHtHLmJ<蘟LIHH'HLLBy61Ht/;t*{t{t1HHHHЍhZ[]A\A]AWAVAUATAUSHHH;=-Ht$T$$H;=o-AƅAA$Du H;=ם-EH=M e!H=<.$H=9.$BYu1hBuH-|.HtHHHHcHHH=!HH1"H= H1"B D= 9.\;.A8. 1E11Eu<$uH;Ü-t E1H;W-ugEu H=L l H58.AHtDEu$D$H5c H=HE'"H8.AEH;-uf8.~C 8.99H5J 1 $ $H1:7.g4H=7.#7.wH;g-un7.~M 7.9CH5zJ 1 $H9o. $H1Hމ2:O7.3H=C7."37.DH;-$D$=!.$t-|$t&H=y7.tH=@K H= (11 7.1H;$- 6.HD$H8Ӄ=.!.$t|$tH=7.t H=J AEt H=J . EtT1ED=6.u8.H8.tHHjH=rJ ^E11H;=-H[]A\A]A^A_AWAVAUATAUSHHhN6.dH%(HD$X1M.t$L$0LD$t =L.T7L.tu2=.6.t,=U .t#=Q.u .+5.H‰ .H4.VADuQ=Y.uHH=pk.HtfH4.Ht$H1HHHtHHHH/k. =.AtHUD$4HtHB@D$4|$-D5m-AAA ߃|$0D |$u.UHt)Au#HBHtHHt8%u !' H5j.1HHHt$HH蔙Ht$H7t$0H{M@Eu k. k.|$0t k.H|$t H|$n|$D k.OoH=h-rD5h-J.t 85|$0tbA3.ADd$ZAtD-Ek.|$DfAu=3.uN;1AE1Dd$E1AADd$RJ.t =HJ.4IJ.t/ELu D$(/HD$MH2.@ID$HIEPցʰΰB|$(Eփ|$PtHtHAVPuHMmMt.IE@MuID$1H81HIgHl$Dd$ ECG2.8M6Mt IF@u.L-n t,MtIFHt5H8Ht-?cu(LuM6D$D$(M1D$1M1Hl$Dd$ MI"H8?-H5F HHMu1ID$1H8BHI@ID$HID$@ IEAHHHH aHHDD$D$ H}%EHt 0.H0. L'HHOEDD$0H]HYh.1҉D$0HHt HH|$@Ņu@uAu |$0t$01蠞uZ|$DkH=Ԙ-?o1|$0Aĉg.u@t g.Had 1R|$DbAu7E1PH߾A$dH/.HdHf_H/.u=ě-tD-Og.EtD @1D% H=C J=1.t HJED$u>=.uHCE1H80I/HCH8HItE1D$E1E1D$D$=R.D$tt=}.u =f.~H=]1Hf.E.t =E.0E.t?+HHHtHH@HHD$8HCHDD$ %uRtN|$0HB H=B HEHI.H=e.HI.HHI.HD$A =-D$4 D$0D H;H}|$AH=2B HH. =A.HCHH1HHT$(?HIHT$(H?LD$(cD$(H=H {!HH!H=Xj Ha!HH!1HHFH=1j IHCHHc.B.=B.S-MH=nc.YIMt6+.H=+.D$L+.D$PH=+.E c.|$0wE s|$uH} `uqg=–-ugEHHuELLHPt$D$HPDD$$ *.H 8EH={? HmD$1H|$TD$01HItH=H1H^L=*.tXL^L)ZH=*.H*.Ht ZHj*.LZMA{L;57-Lu$LYH-3*.H(*.Hu&YH=*.HtYH*.MtH=> H=]H1MH).tT$1HLAHL$T$LE1E1HءAH=n.H=b.H=V.t H=F.L;5-uCHH9D.u31Ht HXH5).H().H)).t HtH-).H== H-).Ht H$]H|XH(./9D$0} t$TL0MtLH=2= MAAw3=.AtV|$tO=.uF_.$At# Au AA E1A|$t A(.=V.t5|$t.H=I(.t$AtA~ ADHD$IH}9L-].MuL-_ 1HLHH诌LHT|$ HD$(HD$tE@t h.~eED$HEl$L$@|$HD$ HCD$4AAD#|$4L(A!σ=C).tX/LHtFH5: 11LH1)El^.A=Z^.L9HHt HuEt !|=.tJ'>H|$(HDHHwHt$(Ht$0H^tE1k|$06D$ s|$4tH|$ Zu#b=t-ubH|$t H|$`|$D'a|$0D%O.t C. @].H|$ t"H|$ YtX-|$0tD%.HuyH= : OHHu71L H5: Hú1'HH1'`K{H=9 ?HHHH2;.t N&111HpH %.HH.i;.t =;.&;.t3!|$DwW=$.uI,HtHlH|$8H|$t H|$PHHSMtD$L=$.D$P$.H=8 # H[.iE1dD$(gHHEP#.H|$|$D)_D%V.H#.HL$XdH3 %(DtHh[]A\A]A^A_AVAUAATUSHGH?.HtHGHDE1H{H=Ɏ-At = .uގ@tEu Eu3At->.tȉ>.>.ȉ>.9.t =9.G$9.thH{迒Aċ9.t =9.$9.t8&>.t ȉ>.>.%ȅ=.[D =.]A\A]A^AWAVIAUATEUSIEH(AHT$HD$1H;1-H|$H\$huY. ЃHD$H;- .~ .u !.HD$H;l-u !.|$`t JY.Aut 9Y.,twnHu Hc\DD\LUt|$tgH|$H=.1:=X.t"HL$H; -uH=W.1D$D$1|$u=X.'t =W.T$pHt$H|$H= .Bu4-DD$`T$pHHt$LAĘH=] .0AWAVMAUATUSHHHLl$0L$t$ dH%(H$81L.LaH$HH$ H$1LCD$HD$(AHD$;yHCHlx|bH|$yPH5E5 1H1W%rtuH4$1ҿ]W.D$(A?9|x6\IHpIAHcD$(IUH=4 H=Q1LH=bZ1LxH=-1t$,H=-1H4$H=R1|$HSt HBHtHHzL$,Mt$ bhx|$,l$(LRQH=4 vHCHXH~-HۉD$t EtKH=3 D5 .EDt$ D 5-ux|$uz~v1AQYH=:QD1AŹ11,H=SA1Ht*K E1AAxH=K-1ZL$t$ HM5gE~D1DdxYH4$1ҿ!C4.t =94.:4.tEExbD9%-~YH.IcH<tHL-R.1H-T.LHHLHDډHq|$Ϗ|$1Ex&D9%r-~H U.IcH<t Dw =.t wH=2 [HH$8dH3 %(tHH[]A\A]A^A_Ã/t@& %}4!u,-(w"#? <}:u|t ~t^t1øAWAVIAUATIUSH(dH%(HD$1߃Au Hnat M`P;;AECL1H1LH1HHRHQaH1LH'tH1HHH9HHHL1IYI1HLLsHAL1I<$HLHHH)IcH|EH~)HM $H > ULHM1IXZ M$H > HIL1%HMLIH1L褟H1Ht$dH34%(HtuH([]A\A]A^A_AVAUATUIS1HHt-?t(ttH1HHH^LL9rOD+0.t LH D+t1HHHH~HYHII9vLEuAE70.t LHEut1LHHH9~L[]A\A]A^HMMI9w/.t LH_t0A]1AELHHH}LHA]YIHL98/.t HHt@+1LHHH}LH%@+[]A\A]A^AWAVAUATUS1HHdH%(HD$81H?HHIA>AHjH|$(1LTHIt%H|$ 1HTHIH\$(u2HDLHH9HNHLD%ALl$ AAuME1gLcE.G|CDOt"..t LHtE>LCIG|IIM9AA-.t LH߉L$lL$IAtLIE1-.t OtHIL)uLM9s]HE1IDHD$E9xIP-.t Lt$JHII)LtALAWIAH|$ Ll$L9u;LH|$(1HHHH {HHHH|$(1HHHHiHzHL$0Ht$HHHHD$0Lq;DLH[H9Hu%HHDHHrzHHHHt$8dH34%(Ht|HH[]A\A]A^A_AWAVAAUATIUSI1HL$DD$ MtKID$LDHHHIuyHHImLT M$$HHtH;t H1F HËT$ |$HHHhCHH[]A\A]A^A_AWAVIAUATAUSI1HL$DD$ MtKID$DLH8H$HIu2yHHImL M$$HHtH;t H1 HËT$ |$H<HHBHH[]A\A]A^A_AWAVMAUATAUSHIHH8dH%(HD$(1DT$LL$D$t">tHt$$LD$$^HHL$AHL$D$ HÀ9t?HT$ HD茩H|$IHL$t7D$ uMt#1I?E1H|$1HT$I9tHMMIt|$ tEuHt-AHt!=/.tH54 LbKI+|$ uHt LUIH54 L1II?uH|$tAA<$u:A|$u2IGH9u&yu @ tKMt|$ tAL@3I9E1|$t |$ tvfKIċD$+uL#Mt&1LHHHvLHYIvIL LIQ}!MHDHHu0_t=A< v$=r-u #t?t*t @Iu-u51}u-=4-u #t?t*@ƀ@ @H}DHIt8uH57 1yH"HuEI1LBU1҅LLt!_:LL9tLLL;HH\$(dH3%(tBH8[]A\A]A^A_SH5;? H1HHHc&.H&.SHH  1,HHA[H5? H1H1  f.DAWAVAUATUSH(|$ H=.H4$1HT$dH%(H$1ue#=-t\|$Hcl$H$H5 1HSH1H H=-1~ ;q-tTH=q-HtH=q-HtH=q-HtHq-Hq-Hq-pq-mq-P^q- Sq-9 Iq-Jq-u 19.D$(9D$ D$HcD$H$HH;-L=L-{-D$kE1L5HH HfILHM4MA:.uLHuMcIKxD$H $HcT$HH`H@HD$D$9D$ tHcD$H$HHt ;-K=-D$D$(=s-td+1{$HD$xH% H-H@`H  .\$(L5@ r .H{-H?.9\$ H $HcL$MA,$Eը@-IE,$EDtD-a D$(H=}.D$,.D$t,T=-芠D$.D$$D$$=-D$,D$(@H= H= -=S.H=x-u6.D$$D%/.%.u =-=-t!H= H5; 1H= 莥Eu 1=.=a-.u H=-]8H=8.1t$(T$ 1H<$=-D$(-H=h8.-=:.H=- u-iA-{-8-u HH:-`-|x-=7.H=7.tD=-E=-81Gu=-uD$(;D$ t =s7.tH=-ջntH=S-辻W|ie$H589 H= 1H= 诣=S-1.'.D$--5-- H=6. H= HF =. --uP=->-"-u$u =Q.u-P- D$n.1-Ņ=g-%-=T-tu-=- =-=q-u"H=' H=;e-y肜YH56 1:H5 H1D$(;D$ t =c5.^=-H=-D$(;D$ u 55.H=-虹=o-=.-H57.H=-5&t$(T$ H<$=-D$(jD$$^=g-Q=-?=-2a=-u=.uŁY-A=6.H= jHH1=G-um-=-t=j-31=-u&-1ۅu=--l=/-_ -=c--u^H= a=B-H= >Kt=-#SH55.={b-F<蜷"3.\b-=i-=Ib-HcD$(H$HL,1LHHbLHq1IH1LH=N5.iL%z2.H1MLHHsbLHH=I2.H 5.Ht H-2.H0H= E1覜Ht @(tLhH= E1舜Ht @(tLpH= E1jHt @(tL`HھL#Mt(9HcYILIH¾#LnHr L#裰AuR1nHt>L$PLatLE11*{``-ljž1=Y-Eub=-t7л&-,--. .HvD$(-D$(1T_-ƒ=-tEux踮HT$0ID(ѵuD$H%=@tE,$H~'A$H`HrH5 1蝰HH1PLHH_LHcF 8IAL1@ǃ~葸蜼H=$ ;H= H,H= HHH5w HE1bHA-R-E..--uH5 H- ʼn--;dt--sLuA.Lr HHL.11H"IHt$H5u HAVH}tt;e->-t+&..%H5+ HnAH5( HR -;euH5 H)H5x H -.}A.H= <H=\-+H= 躗HH=-襱R1=-]-P-FH= 裟H18(HYH5] 1aLH1H=$ ^hH= EOH= ,9H= H8HH= =-u2H= ѺH= 踺H=Z 蟺f.1I^HHPTL H  H=lZ-DH=-UH -H9HtHY-Ht ]f.]@f.H=-H5-UH)HHHH?HHtHZ-Ht ]f]@f.=-u/H=Y-UHt H= Z-譵H-]fDUH]ffDAWAVAUATAUSHHH-H5 1L%8-L5 HIH¾H1脳H5 1HC HH?H 3 fDI$HI H1LH0HuH5J 1E1E10荪HHL5 ۫H5D 1hHH轫Ho-IH2HHuHH0H0HtX>suLuL` LLD$DLHH0YLHէH6o-ILD$@Mti[L~HHID@H;-t]HZHtH5A 1HHHپ1LrEuH[]A\A]A^A_H-H5P 14HHH1蟱H-H5i 1HHH1pH5 1ݨHH¾1KH H5 1諨HH¾1H5 1膨HHH[]A\A]A^A_1H5 1HKL HHپH1诰f.SHt 8Hu H[H[@f.HgHƀ-uPH1ruH= Hf.USH=4V-OHH(HH蘧HxVHHDHk(H V-Ht }pVH/bin/shHH[ HU-H@HxGVHHHU-H[]ʫf.H5 1ͦHHHU-HxUHH藤H[U-UH/bin/shHHEU-U/fH9U-H[]>fDH耦HxUHH,SH=-H=j-赪.tH%-Ht)5uj1uV {.u@4p-t =m-ue'.t=G-tTEmtv4@HǭSH=V-H=-1Nu蓭f.v-t;f.H8-HHƋ>-u&>rt H@H= €uH= H=* H= H= -H@USH=$S-xk=S-x$S-S-S-S-H[]D-R-R-H5 1Hlj1f-R-R-H5 1Hlj1c@f.H1pxHw(R-u6~BHG]#.R-9#.H@yf.@f.H=Q-t@f.H5 H1 H1H=-莧oDf.SHu".̴ Z-t ={".u1".H".t D$ wD$ H[DsuH= sHtH5r H=!.uH=M 1HHt*H=|-HO H1薪H`H=" yHAUATUSH<z-H-E1E11ۋ.ua.uG!.ŋ4-tHtE~1[LH[]A\A]Ð f=b.H=i HHeHxHt?1 E1@HAGH5!IǢ'fE1E1DSH E-HD$D$ /- -@D$ --WWD-HD$Et -q.-9e.DHD$HtH|$uHD$-Nh-WH=i.1-M5H=5-G-t|DH-H=Y-Eu5-HH|$d - N-H --!.t*H=.HtHHt 8~H6H|$,Y..= .!.-H-*-f-[ .--H [fDH5'D .Eu  .D .Et6HD$H=V 1ɉھ8DHD$HtH|$DHD$H5Tg.1ҿȚ~.Hn-H5-HH=-5b-tH -Ht-Hc@<fDH9.Htt HH".Ðf.H .HJH .@zn-t =GW-)M-==)( &1ÐHc-H5-H -H9s( t uHDHH9tH t t1-t]-=ff=I=}- fD;t{t1d1=-|- v1<Df.USHH-Ht4fDH{H+HtǘHCHt`HH诘HuH-H[]SH-H蠛HxJHHLHH聛t0HcȀ| u&HTHH)H Hz u H9Bu=[-H5o H1H[ f.HH=-H5.-9H="-HifUSHH=-Ht&Hc-HH8X裗H-B-* P-貽H-1H=-HZ HHD觱H-B-hut H3H-L-HH)- pHHHckIHcH- H-HcH=-=-nH59H;G-HD=O-1PfDfD-H[]f.H5.@H=.Ht Oft?F))(}3 t.&t)t%1=-tpfD}{{};u۸(} |~ׁufD)H'} wF--[{@/FfDf.SH5H-1҉Ht [H5F-1҉Hu u.wH C HcHf.H=.Ht[H5 H=y.Ht[fDHc=a.[;.HQ.H^HHmHxtFHH[AWAVAUATUSH8H=C-dH%(HD$(1HH=-HpIzFMIH-HD$ L=-HD$A?HD$1E1HD$JHtaHHHD$HHD$ 1I9ADtMHD$ IHD$A<taI^HL$I4/1HH)迖HuI9HADuHD$(dH3%(unH8[]A\A]A^A_1ADHI9vADHI9w1RfKD5MM9vHI9uf.ATUASH8HDH-HD`@4HhHPHm-HP Hj-HP(L-P0t{HT-@4HMH?-1HH;-t#;t{t{tH[]A\H-H--fH-HH-f.HH=-Ht苑H=-HGWH-HG(H-HG Hv-G0a-.t5.HHZ-HGHt`(Hs.f.AWAVAUATUSH=.tHD1-EL%-Mt A<$H5z 1螓H.@f.H!.H*.HEH-HH".fAWAVAUATIUS0H- HdH%(H$1HD$(0o5D$$HHD$(H$HD$$HD$fDE4$Ml$EEDO-Et A!A\HcD$$Ht$(PHcH9s-PHAtQAtKT$$D8MHcD$$fDH0H9sHHt$(5HHcD$$PHAufDT$$HcD$$PH@Et$AFEOILLT$M|$}MLT$vf.M|$/AvD LY,H HHD$H1MLT$f.;eHcIIH=-L-& 譃覅H4H`I.=-I A= -ABI AB\H=-IIHNjP.-u-MNID -I!fH=' L$qHHL|HAWƄL袱L9tHL蝄L--u-LMIl-AaIAeAr DDE:M|$ABM)D=,-tIBA\D$@LA#D$AABABaML H!%tDHJHDщHL)Hz,LE}Hx,LHk{IL}Hx,LHJ{IH5K,HM0{I.H}HRJH=ƹ oH$t8S/ /L~HHHD$|Ht$HLHX+A[IH¹D$ M|$AMSL*~HL H!%tDHJHDщHD)"L-*-O\MfA2Ll$0LLMl$4yLHD${Hx*IAD$HL$LuIHBAEt<}uA?Euu%XAGfALD$@LLLD$貁LIĉD$SxELD$D$@*-M}u-LM JIHPD$h$-< HHvHǰ-|0-t-H--HHzHׯ-H=د-HHDOz4#H-H=-HH-1H/-:Ho-Hz4HI-fL5-I----Dk-AE31OHtLHL--0&H-HAA D8HScA\H!A;-ANjb-`-EtH5P-HY-HlSHcH9wfHH9sHH5-%H-HAUA>Eu ӭ-Hͭ-Hҭ-}D2-Hǭ-EH;D=-~3Hc-H߅tHv-|C&Ht 8;-=-=?-H=T-HcH 4-H%-Hw HrH9=-H q DH -H=-?D)D-AEtD A-EtPz@H=x-wfD*fD=j-ͿH i-@HcQ- >.tH8-|'u>.HߺL$HH-L$IH9؉ >.tIHpML%-LsHHǫ-H«-uHƫ-fDHG -H-H-HȨ-VAGDV-BfD=B-襾C-1¹'Dz-Ef-111-K]fDkfD=-%H=ȧ-,$̧-H=-voH-H-,$H-12;=N-X-HO-A}D&fDH=-HD$/uHD$H--?-1$\jH ٩-"5-hH=ۥ-H{ Hپ1yFH5-Ht H~xA@@gD$\\WHQHqHHK- H7-HH-H3EH4-oH=- $qAVAUHM-ATUASHDW-H-Etq-L5^-E11f--F-t؃ɥ-U9|-H=-)ƒ‍5-HcH-E\E - -- A-H2-HcŃ\-0f=--#2DH-HcՃ tcE1 -tA>tx fD۵ - MY-="-腺HcH(t8-t Y-u4H[]A\A]A^@H=ɢ-r|H1[]A\A]A^HHD$-BHD$H[]A\A]A^=-5-0-_f.AWAVAUATUSHx|$1Ht$HdH%(HD$h1"HC-HtH /-Hv(-D$'D$^"t$^@b-A2t=#-EAA2@A@1Iŋˢ-D$D$D$(D$HD$D$Xf.1|$'t 1A @H EAEtU)uP|$uIAHcD$A| @IUHfHcH< t);D$,- DADŽAA |$^1)6fDHq(D H5-HL$H|$E1)(ITDADASH|$GEAAAπD$=--DH--DBƃH ߣ-HvHr-| AEDDELcՁ ED$ H-Hd H-|R fD4 qAL\$ DD$@LT$8tHLT$8DD$@L\$ Qt#H -H< H-| * |$O At #A@uB tt |$ H+-Bu>H -Hv-HL-  H -H AD$ u < Du #Dڃ@)/(H-HvH-|l$@D$D((@DeE9|DLD)Et@Ic6IHcAA\-t D$@(|$L$D H|$A D$ADD$ÀD4 Vf.AD$(EIfDEA ^-|-ED9|D)LEt@IcIŃ6HcŃA\fDH-HvH-|!D9|%LLT$ D)Et@IcLT$ IMcCDEC\ fDEAAD|$(JD$(D$5fH )- BusH͟-HvH`-|TE9|CDLL\$PD)L$@LT$8DD$ Et@IcL$@L\$PILT$8DD$ C\DD$PL\$@L$8LT$ \$_'9LT$ L$8L\$@LcD$P H*-L ;@ƃ&@6 |- Hd H -HT HqD H5՞-oAt'HcD$A| uIUHH< tL$DL$,EHc|$HD$L8ZD-ED$Es- =@AtDD$E At |$(w ##l$@DE9|/DLT$8D)LT$ Ft0@IcWT$8LT$ Iŋt$CTH5&-Ë\H-HvH 4-|Hc z-5x-He-y9EU-A'u EHL$`E1ډމX HD$0-$-H=-H9|$0 ET$`}'"uoH-HvH -|tTL|$0L$XLD$d1LILHt$d1H@0HHD$0aD$dl$@PT$`D9Ht$0HcL-bl$`H|$0?a$FEAL$HD$HtHaHcADHD$H(HL$hdH3 %(L Hx[]A\A]A^A_H -HH5-|wDA_؃߃[t (LH-HvH7-|6A@R(W{[& H=И-H9|$0< D$`DA9D)LFt0@IcIHt$0IcL`D|$`D0H-HvH-|l$@l$D)t$,t,HD$I| 8HcT$,Ht$,`H|$Ac_HD$D$}DHa-HvH-|HcŃADAwAD@H -HvH-|EADD$DʼnD$^]D9|%LLT$ D)Ft0@IcLT$ ICD<q\LX^HD$HtHF^H5O 1L--a|$XHƺ)1ٱ_- f.E9|0DLLT$ D)DD$Ft0@IchLT$ DD$IC\DD$ES)fDH|$0UFH !-BH -HvH"-| oKDcedH=ޜ HAD$DHcT$,Ht$]H|$AE1\D$HD$E9C\D$DE:f.H -HvH<-| #E90DLLT$8D)DD$ Ft0@IcLT$8DD$ ICD<DD$ 'dH= H -HH2-| D$f.Hi-HvH -|L|$0HL$d1L8LH H'HIHD$0YL]l$@‰D$`rD)LFt2@IcO IZHH -HHqD H5-EDD$A-$D HLjT$ 5l-Hc Hc Y-HJ-T$ &@ƃ|@u ; D9HD$_ED$ACD-UD9-&fDT$H ͓-H:H\-| @H-HvH4-|jA##al$@(D(RH= H€AD$A-H $-HH -HHrDH5-<EaLDD$D)Ft0@Ic4 LcD$IHL$`AA}{1HD$0*D$D$  <H= HƹAD@DDHL$`E1][1HHD$0t$LDD$@L\$8L$,LT$ 蝝1HHD$0޺HHD$LT$ L$,L\$8DD$@H|$D$,tUD$,tGD$,t9DD$PL\$@L$8LT$ T$YL$8T$DD$PL\$@LT$ D$,HD$08AH|$0DD$@L\$8L$ LT$VDD$@L\$8L$ LT$LULl$0D9|LD)Ft0@IcWIHcAAD-ED$A9H=M HH=< €FStH= H€+H=s ҍ-QH|$HDD$@L\$8L$ LT$ZLT$L$ L\$8DD$@%D$,*Xf.AWAVDAUATUSHht$DƉT$ <$HL$ dH%(HT$X1҃DD$t$t"Gރ> H!@1H T$@A@<$"EE1D$0]IŋX-D$D$4HD$PHD$(HD$THD$H@1<$'t 1@@ AA E#IcAǃD @ -t |$'H -HH5-|pt$9;t$ %@|${H 9-HvH5̎-|tD$ENE9|0DLHT$@D)DL$8Fd @IcdHT$@DL$8IŋD$A\T|$'DT$A@\E|$ƒ%  A H -HH5-|,AH S-HyH5-H DD$ -t-<Eu/@u<$' 1EA)E~E9|DLD)Fd @IcIMc C\5EEp,I |$uXH= DL$@DT$8THDT$8DL$@u1HJ-H Hٌ-|DD$D$fDN-t ='-)L$ 9L$H -?H-HvHs-| Hc- -H-r9A-A'EH-HvH-|DD$0HL$('''DL$@DT$8A[DT$8HD$DL$@AFD9|#D)LHT$8Fd @IciHT$8IŃA\Af.;\$ VD$t$ 99O@D$`$$E΋D$bIcIADHD$ D8HT$XdH3%(L& Hh[]A\A]A^A_E1H .-HvH5-Aǀ|LAAE~E9AADMcC\5EfH ɉ-HvH5\-|tE|$ EA~:H -HHH5-|^~|H= DL$@DT$8QHDT$8DL$@H -HD$f|$"u(`u#H-HH|-||$`)@؃߃[t ( H-HH1-|E1IcDHi-HvH-|EfDD$@'D$DD'H-HvH-|E@9؃߃[t (&1;\$)D$({c[H-H9T$D$P]DD9Ht$IcDL$8LMDL$8DL$PH|$DL$8#LDL$8fAL H5:-AD EDLHT$8D)Fd @IcRHT$8IDD$@DD$0HL$(ډމDL$@DT$8DL$@DT$8HD$--H-H9T$ET$Pt'"t:DD9D)DL$8Fd"@LIcDL$8IfDH|$wH-HvH -|AADIcH -HvH5T-|.AE9|&DLHT$8D)Fd @IcHT$8IA\PH i-Hl$5DLL--!JH5* 1LT$ |$4H1輝B-DD$ \H-HvH-|DfDH5Q-|G11D$@fDt E/AH Y-H?D$"HL$(DD$01``DL$8BH -HD$DL$8H98D$PDD9|#D)LDL$8Fd @IcIDL$8IHt$IcDL$8L|IDL$8DL$PH|$DL$8HDL$8f HDL$8HcDT$ s-Hcc-HT-DL$8DT$D=,EuD\$0EH4-HvH ǃ-|HL$HH|$1DT$8S&H|$I=-*rDD$0Ep|$uDT$8EAT$TL|$T$P5c,u L$0=H-HvH '-|LD$HL$4H|$1H|$I7t$T1LLHD$GD$TPT$PENH|$eH5-|,|@DD$D$Ht$(1DL$8\DL$8HD$"D)DL$8Fd @jLFLl$(H/-|DD$D$W|$0LLHD$6FH|$LI‰D$PDD$0HL$(}{1DL$8AA=DL$8HD$sDD$0HL$(][1DL$8DL$8HD$D,LL-6~-ENЃ^!AMH-HH5'-%L LHD$MEH|$1HHHH‰D$PD$lHIc@AUATE1USI)1(HHL$dH%(HD$1 HHP}-H91)At$H-~HHcvmHF-|u_HËD$HHAPHcDHcD$DI$HFDHt$dH34%(Du~H[]A\A]KH(D$H{HPHcDHcD$)HcD$DlHcD$E1DDD$xHcHJAoGAWAVAUATUSHxD=k|-dH%(HD$h1EtDA<|-@H\$hdH3%(D(Hx[]A\A]A^A_Ë-O!AZ$HC- uA#A SB-H}-HvH n~-|Dƒ<D‰€濨@-t D;=-"lA9N"A&E!!HT}-Ha*H }-|O*1A>!A&))H}-H *>)H |-H)H|-H)HrDA+H5|-4@=|-(%5% t(H|-HvH )}-|8%߉-D x-H=g|-Eu(uLD$IH?[-AVAFC=HcHT$LMA((LP#T$T$XLE1DrHcA)Q"D$L/)HǁHcZ-HZ--aZ-D$@ {-/{%AqZ-.--nZ-\-Hk=QZ-H-6XZ-%-A D=Z-H0Y-Y-A{O\-H=Y-*HH@L`L8$xHHc:LH!HcHD< t< tH=%,H4u  HcsHHσ,H[-H>H O\-|,>mc-A1aH -=W-+-A;A>A|RA<m۩-P<H Z-HaHZ-HQHrDA#H5Z-'{n{=A -W-A)E1D$L$Ll$Dt$E1D$@D=0ILD$-LD$[LD$MtLLD$ԚLD$H=hW-Ht(L=@Ea@XHX-H1H MY-|A&HX-HtpHX-HtdHH@tH pX-A)-ЃA(H=BX-HvH X-|9 e-5U-1Ҹ1ҸE1=|$|~A-GA 5A!*t DqD5U-A}H5s 1U|$H1pLD$gHfW-HHv-H W-|u =tS-Hk-=V-gH W-HvH W-|_T-%-V-+fDA||A/ OAQAdR-) @D$@E1+HV-|`fA"S-B-٤&tEH U-Ht(HU-HtHrDA'H5U-:fBS-A''HU-HvH ;V-|tA)Mc=R-tuPA&HHútZH5q 1 =R-HH1mHH5dq 1A=R-H1mgH5q 1=kR-H1qmDHT-HvH XU-|A%HT-HvH .U-|A*A&|80HUT-HvH T-|A.YHT$`1@2HAH[Hכ-zQ-H|$`S-XHT$`1HAHV[H-2Dd$@A;HS-HvH *T-|-A(-A|utHQS-HH S-}P-A+H#S-HvH S-|A,xH S-|QA$V{}AH-A-O-A#HHD H WR-O-A}O-Ae-AQ-ʀA=-lA)-X- A-7Df.H@ &O-u-N-t(-wK N-tHfDATUSH=tM(9==tO=H5mo 1=N-HƉ1iN-1HH[]A\H5-H>={\~HHź:H5k 1=={K-HH1fH2HzFD ~HHźH5l 1=(K-HH1fHf.#sH5- DHtH=AK-}HHźtCH5|j 1eHH1&fH^zf)fH5R 1"H1eBH5j 1=AJ-H1efDH=Q j;-%(-4|HHźt}H5j 1=I-HH1CeH{H1LY J-f.H5k L@z=zDH5Xj 1 =GI-H1dH-K=u4H5ݓ-11ҿZH1H¿}ZH5H߉D$ 褋D$ {HHút.H5h 1~=H-HH1;dHsH5h 1P=H-H1dlf.S=H- Ht [fHH1[YS=H-!Ht [fHH1[xYAWAV1AUATL%ob USE1Hx--Lt$PH$f|$PdH%(H$h1H$Hl$LLt$D$MIcE,LA3Et>-o=0EuA~gfDHQ` 4HtNHS Hc0)HHcHHHHRHT$ j(L P IcLL$|$u;=-hA3-u$DL9tkHHHE,DA3tAA~wHT McfB-H=>-TLMк2EHU1ɾLsA>-H=}>-Hn>-SLMкHUU>-1H=L>-LsAH.>-SLMHUH} LsAH=-H==-DSLMкvEHU1ɾ LsA=-H==-H=-SLMк7HU=-1H==- LsAHr=-RLMEH}LsA>=-H7=-H=8=-RLMкE1ɾLsA =-EH==-<-H<-?RLMкqE<-1H=<-LsA<-H<-QLM,EH}LsAs<-Hl<-H=m<-QLMкE1ɾLsA@<-EH=6<-(<-H!<-tQLMкE <-1H=<-LsA;-H;-/QLMaHUH}LsAH;-H=;-PLMк$EHU1ɾLsAv;-H=o;-H`;-PLMкHELMLsA3HELMLsA3HuH}LsAKLMHuH}LsAQKLMcHELMLsAGHELMLsA+Hc,H:-H=A LmD4C1H_DH}DLHLsEg,LMA3L, HELMLsAHELMLsAHELMLsAjHELMLsANHELMLsA2HELMLsAHELMLsAHcw,H|9-LmD4HEHtH8t H1;EH}DLHLsD3,L`jA3, Hc,H 9-H=-@ LmD4EB1HBH}DLHLsUDñ,LMmA3, :-HuLsH}D,LMA3f, HcU,HZ8-H=~? LmD4A1H BH}DLHLsC,LMA3, kHc,H7-LmD4HEHtH8t H1CH}DLHLsB,L`A3, Hcu,Hz7-H=> LmD4@1H,AH}DLHLsB4,LMA3, Hc,H 7-H}1Ls HUB,LplA3ǯ, 98-HuLsH}B,LMA3, Hct,Hy6-H== LmD4?1H+@H}DLHLsUA3,LMA3, Hc,H 6-H=0= LmD4H?1H?H}DLHLsXAƮ,LMA3, Hc,H5-H}1Ls HU@w,LpA3Y, u7-HuLsH}4A2,LM,A3, Hc,H 5-H=/< LmD4G>1H>H}DLHLs?ŭ,LM_A3, 6-HuLsH}@,LM]A3h, HcW,H\4-LmD4HEHtH8t H1@H}DLHLs5?,L`*A3, gHc,H3-H= ; LmD4%=1H=H}DLHLs>,LMDA3, 5H}-LuLtLt$(oqHD$(|-@LMLsA3!HEHtU PLMLsA#H}Hu;LsA4=LMdH}LMHuLs&LL$(?$|=A4LL$('H}Hu!LsA4K=LMHEHuHPHu HH HuH2LMLsA3HELMLsA3H}LsA3JLM111CUH =;u 1-;LMLsA#B111CU PU ;LMLsA#H}Hu|LsA(<LM$HLMLsH!AH;HLMLsH!AH HELMLsA4lH}Hu;LsA4;LMBDz-LuELtLt$(nHD$(-z-@ULMLsA3!HLMLsH!AH 0H}1&?:=z-tHD$(3nHD$(y-@LMLsA3!yH}LMLs&LL$(?R:A3LL$(;H}Hu LsA4_:LMD^y-HELsLMA6EHD$HLL$@T$(gmT$(LL$@HD$HHuH}LsA 9LMкHELMLsAH}Hu;LsA9LMк"YH}LMHuLs&LL$(?q9A"LL$(H}Hu!LsA@9LM"Hco,Ht.-H}1Lsr=P,LMjA35, Hc$,H).-LmD4HEHtH8t H19H}DLHLsr9,L`dA3¦, 4HELMLsA#H}Hu LsA<8LM"HEHtpLMLsA#HELMLsA"HU--1H=--LsAH,-;BLMmHUH}H,-H=,-BHcv-JLMLsA uv-H /-HѺ EHU1ɾh,-H=a,-HR,-AHc2v-jJLMLsA v-H .-HѺHUHELMLsA3HHELMLsA3jH}1LsAu;LMGH}HuLsAP;LM"H}1LsA-;LMH}HuLsA;LMHUHELMLsA3HHUHuLsH}AT ;LMHUHuLsH}AT:LMeH}Hu1LsAT:LM>HELMLsA3"H}LsA3;LMH}LsA3>9LMкHUHuLsH}A35:LMHUHuLsH}A3 :LMHuH}1LsA39LMgH}LsA3BH= 1 HBLMH0HuHMHFHu HHHuHHELsA3H8ALMHHEHuLsA3H8ALMЁHHuHMHFHuq HHHuHH=G0 LsA38ALMЁHcHuH=0 LsA3 ALMH4H}LsA3@LMЃHHEHuHPHu) HH HuH2LMLsA4HELMLsA4i*-H}Ls W*-HuA3>LM 8*-H}Ls &*-HuA3>LM U*-H}Ls )-HuA3r>LM $Hc,H'-HuH}Ls6,LM1 A3e, HcT,HY'-HuH}LsU63,LM A3, H}1LsA0LMg-%-MH%-i-E&-t 7&-%-z ,9%-h DX%-Hl H7z H5- EHE11H=$-HH¾1Ls%- p- O(- H%-?v_D-$-H$-.%-ESD%U-1LE@"LuA>MuMnHT$8H1ɾH!H#D$0HHH|$8HHHD$0:IUHuHH HuHHu|LALs0LM$EHU1ɾ LsA%-H=%-H%-[:LMкHU$-1H=$- LsAH$-:LMMHELMLsA3H-HLMLsH!A3%H HLMLsH!A3% HELMLsA$HELMLsA3HHEHULMLsA3HHxHEHULMLsA3HHQHU#-1H=#-LsAH#-8LMHUs#-1H=j#-1LsAHO#-8LMHuH}LsA-LMH}1LsA,LMHEM+"-H!-l-LŃ@%̀1il-EHU11LsA"-H="-H"-7LMкHLMLsH!A3%H HUH}H8"-H=9"-7Hcl-IJLMLsA k-H $-HѺEHU1ɾ!-H=!-H!-!7Hck-JLMLsA k-H #$-HѺ%HU!-1H=~!-Hj!-6HcJk-JLMLsA *k-H #-HѺHUH} LsAH!-H=!-R6LMкMH-HU -1H= -H - 6Hcj-JLMLsA vj-H #-HѺ HUo -1H=f - LsAHH -5LMHUH}LsAH -H= -^5LMкEHU1ɾLsA-H=-H-5LMкQHU-1H=-LsAH-4LMHUH} LsAHV-H=W-4LMкEHU1ɾ LsA&-H=-H-c4LMкH, H 77 I2=HcD,qHHHH)I)I]DULf]LHNHNLIE5&h-95Ph-LMLsA3!-LHpHp5g-95h-FLMLsA3!oHL$ J5g-95g-ZLMLsA3!VA3 FA3 6A3 &A3 A3 A3 A3 A3 A3 A3 A3 A3 A3 A3 vA3 fA3 VA3 F6A"LL$(,- 5A4LL$(5A3LL$(A3 5A3 A3 Z1L1^A3 - ^-;OV[LML=-IHe--H-+-z uHL1H)He-$HEMH^-@HQZ1HÐf.AWAVAUATUSH(D=H-D5&-HT$H|$胱--d-D-1-D%-D$F-D$UHT$LD$H5GH=G-qd-O-I1-HѺ4T\$t 5d- 1=0t6 H=d-HL$H=0us- Ut$D$D=F-D5-D-0-D%-^--c-H-H9H H;H(H1[]A\A]A^A_%T$2-)-c-c-T$OKXT$Hۉnc-tH\- TD$D=6F-D5W-D-/-D%--b--D$tH-HÁ%b-H9. -d-u -u>)@Hc-8YH(H[]A\A]A^A_fD~)@f.HSHSAb-FUHC-C-C H-HC(b-C02E-C4Q-C8`,H[]p-HcDL H=,n-; ,9PH[]ATUHSIHdH%(HD$11Hú HHRuv9HPHt5u <>wHs1@HP1Hs@f.ATUASHH8DGu_ult`=t[1[HUu.dfDOu_u:t0=tH[t:+uՀ:=uЃ[]A\À|5=BtfD1[]A\ÐEt[t111҉HH|]HuЍ@HcL5+t=t1Df.S11x#%u[É߀[1fD[ÐH1Ҿ1H@USHc1H1Hy1҃;H[]@H=) H1xHf.H=Y- HtHǾ1IyHATUISHH@dH%(H$81HtOHtrHH9t*1H$8dH3%(u}H@[]A\fHqH9suH\$HHL$HuHL$H$LHvHfAVAUATUASHdH%(HD$1ZEAA tzLl$~e1Lu9t#EtމtEuaHL$dH3 %(ukH[]A\A]A^A~7=OÍXN@H=-,9ufD#ff.~0< t)t1VHHD< t HtH9u1ff.SHx*;@r{@^C1[SH?x{xH1[f.HHHdH%(H$1fH$dH3 %(u HĨ@f.HHHdH%(H$11҅uD$1%=@H$dH3 %(uHĨ+f.SHu[ÐH߾r[f1Ht?.tfW/t't#.uW/ ff.1Htt/t1.t W/tt.uW/ Ðf.H/bHH@Ht?/tH1HHVxfDSHHx|HH[bf?/t#S/H}HxHH[HEDHuf.ATIUH= S-Ht4HH=~$HcLHHuI4t/uHuH$I9#HL)H)..I|$HcfA$AD$.HAD,H D/tHPHHuL`@DUSHHu4uHH[]fDH tHH[]鮕fDHH1[]1馢fDHUSHHHu9uOI<:tetaHcƉHD D:tIHu9։Ut6HH[]-DLcIA<:uLcIAuA8tFE_yH[]D1D1@HHG--P-tDUSH- H! HH(HXH@H-ڋHH-HK H@H-Hv,詋HHhH@HN,艋HH@HO-H[]AUATIUSHH,HTfD9t$HH9u1[f.[fK,H,HtHt,fDfDATUHSH=,HtEH[]A\fD軇,Hf,~91L$H],<-\[,I$CH9H+,HtUHD$v=$,HD$gfDH,HtHt,fDfDSHHHc=,tuHH[@HsD,H,E~+APH=,H41  HH9uHtDH[HD$Hc=S,HD$pD1wfUS111HOHt*HxH>sHH1H+HH[]Ð,sfoN Htc:/usr/HH @(etcHfo; @HH[]f.AUATIUSIԉHr HLhL`r(HX@H@H[]A\A]HbrHV -HS -FrH3 -H$ -HDf.& -~&H - -HH@HÐHq@HHDf.USHH}Hu!qHHH[]HpHxwqHHHHH[]Df.AWAVIAUATIUSHL=p 1H(dH%(HD$1HD$IHD$HD$DHcL9sXI4<$<'<`=y-~tA<s6HcL9r@H|$dH3<%(LuzH([]A\A]A^A_fDLHL$1H)Hl$HHs8HuKAL$mD<"`AL$UDHl$>@f.SH7HH[f.SHH\$@|$D$dH%(HD$1HHHYHT$dH3%(uH[@f.SHHn -~&HW -Z -HHHXH0H[Ht$9oHt$HXH0H[Ht+?t&SHMHHH21H[p1f.USH Hn(HX@H@H[]fAUATAUSHI Hn HDhL`HhjnHX@H@H[]A\A]AVAUIATUISHAͿ "n HLpDhL`HhmHX@H@[]A\A]A^AVAUIATUISHAͿ m HLpDhL`HhmHX@H@[]A\A]A^AWAVE1AUATL%ZUS1E1H(HGH|$Ht$T$ H$L0fDA< tU< tQ1LL_HcL=4u 1Iǀ;taLsA< uID1L<IuHjIMtLC;u([lHD$ MCRH<$L{cH$MHCzHD$H|$LkHC 5 l HX@H@H([]A\A]A^A_E1LI=D1H$HxH$H51 ~H5 1)|$ H1 HD$H5 1H@H|$ H1H LH<$L=-H(1[]A\A]A^A_H=0 H<$IL{fH=0 H$H$MHCH=0 |Ir@USHH}j HHhlj HX@H@H[]fDAUATIUSHAH#jHHDhL`tH}t H1HHk iHX@H@H[]A\A]ÐATUHS IiHHtH}t H1#HHkLcHHC[]A\fAUATIUSIHտ HSi HLhL`Hh4iHX@H@H[]A\A]f.HH HHUSH HhHh,HCHhP HHCCH[]f.AUATAUS(HIHH`h^,DhL`HhHX PH[]A\A]fDSH "h1HHX H@@tSP[f.S gHg,HCH@H@PHHCC[Ðf.USHHHtjHu=HHuHH[]HHHuHCHPHHpHH[]@HkHu%]7-HEHH[]Ht$H<$ 47-HHt$H<$mDf.AWAVAUATUSH8DwH|$ t$,AFHl$ 1HE H8HIHD$H|HÉD$(HE H8IHE L}(@1E1D$Hc1HD$@|$7FHI ]-2,4-LAE'EtD$(tyHD$D8 tWL߶D$HA9|)DrLHT$DHcH"fHT$IHcHcLLIcֹQHT$HLu@HD$A< uM ADHD$ H@ L(g,H8[]A\A]A^A_ET$(tGHD$D: uHT$HL蕳t)A fDIE'A tDHD$A< u[H5,L@H5 1eH8DH[]A\A]A^A_1 f.vdHL$ HA(`dIDH5a 1HT$t$,H1DAVAUIATU0SIAHdH%(HD$1cLpL` H@(h@DhHHN HHcH@I<$HH$HcH9L<,1 CH$C Ht$dH34%(HH[]A\A]A^@CAM,$L HL8-uI<$S1 CCA|@CBlH5 1yH1ӳAVAUAATUHS IAbH=>L`HhDpHEl$H@ԜHt@(uyHCHH}H蠯HkHtHHxbHH軰HHk aHX@H@[]A\A]A^fHxHzWo1)HHCh@,HnH HEHCAf.USHH]a HHhFa HX@H@H[]ATUHSI aHHHx`HH蝯LcHC `HX@H@[]A\ÐSHuUHWHBHtH8tH1HSHBHBHtH8tH1HSHB%0-H[H= 1ɾH؁%d0-[@f.USHHGHhHt Gux;tH[]VfDHEIL!HuQHEx;tEDHAx;uHHHHL!HtHHHUHBHH[]fDHH,,,H,fDHHm,Ht85Z,;5V,|Hǃ怉5E,Hcy_H:,HD?= ,Hc^ ,H ,H@f.AWAVAUATUSHHhdH%(HD$(1H$Ht$8HT$@HL$HLD$PHl$HD$HD$0LL$X$Ld$HD$YxD$@tQ<%HS}D$HAAIHc=>,LLH=9,fDH{*f.HkH=N1>H}H5JH=1 H}H5,H=1H}H5H=e 1H=7H} @,,H=, H=1HC,Hx~H=,t H=M hH=1j5D^@,),H=H=M 4H=l1ɾH=.1$DH=Y 1?,,fH|$D$ @l$D$&uHCHxHzH=1HC,HxXH=P<;H= 1R=,+=J?,=,KfD&W;H=>,=F,HmL H=HE5',H=D 1HCHxL`H@H@Hx2>,-,),MH=JLLe fH5A1݋H1AHCHx @H=H=41HCHxHD-,Et,H=1͋f.H,,H,H,Hff.Hb,,H,HHI,H5 1Hf.USHH= 1HHHH}@,H=#,t H=\J xH=:1H;<, ,H=,t H=J <,),/HH=[]]f.AWAVIAUATUSHHD-,D%`<,,8,He,t ?HH=1AA<I,H=C<,;,1L8 HH-,D-,D%;,H= ~EL%,u A|$ HnuAHL[]A\A]A^A_H= H1RDHL[]A\A]A^A_fLxH@H@Hx-L,MD-F,D%;,?H=,LL{.@H=9 1:,,H=,H=12DLHIt$HPI|$uSHH?Ht1,9/,|H[7HHHCHc,P,H,H[fHt3SHHHu>H{ Hu%H{HtwH[~fDfDff,9,H| 67fDHHHGHcT,PK,H8,H<HAUATL- ,USIHHHH6HtAH{H+,9,}L#LcHHc,IUH ,HHuH[]A\A]@@f.HATAUSH4KwLH/|u4u$HHHt6CH+tH{H{(H{ HHHu[]A\f@f.Ht;AUATUSHHHHt@H HcHDfDHkH}H}HZHH[]A\A]HHCHxsH{*HCHxHCHxFH{HkH}H}H}Hсr@HkH}H}H}H衁B@H{0f.HkH}sH} HbDLkI};ImHt&H}9H}pLeH$MLuLH{f.HkH}H}H}H} HaHkH}H裀DfDH=1ɾu&SHHcH{H{Ht [[[fDSHH[>f.@SHHHtH[DSx x[[@f.SHH[ifH1ҿS16[馌@f.USH5H1cH[]H1Df.ATUSH0dH%(HD$(1D$%qHHL\$HHAH?IgfffffffL II)LHL)HH)LDILH?HH)HHI)AA0ICIHuDMMcM@DLcHADuEJBmAIgffffffff.HDIHH?HH)HHH)A0HCIHu̍MAHWMcHcL)IDB DICD uLcIuItA$sLcIH\$(dH3%(A$H0[]A\E1L\$1DD$ t$H<$FHH<$t$DD$ ttHHtl.DƒA$LcIiLcLAdIDA09AAD | E HfDd5LI.d@Gu |D[f.ef.AWAVAUATUSHHAAtHWHt HS Ht Set*HSH:J@=@ƀ= E1AA!~u @`E1HSHz=1,L=> 8\Hŋ,HS HHz,E,D[-,Iŋ ,H~> MLDE LHAL9tH|{M9tLo{Et EAEHD[]A\A]A^A_DHSHz 1a[HH o,L== HCHE1H8AL9tHzwfD1 [HHHC L== HxE=7,ZIfDHCD,LHl,E1H8DD$ PDD$ ADJ,fz@!AE1D D1 ,:Z-,HHC L=< LHx#LE1zAHS{MHDfDDYIE1E1XDH-C< IHS{E1HDL@,uHCH5 < E1H8ADH{OAH{7AH{ #A|H{AeH=1ɾ5=5, DMSHH1ҾHH{ 1ҾHH=Oe1Ht@(uH9CtH[Dx@H9CHxu1ҾHH[xf~JUSH1HDCH9E~%HE<tHECH9EH[]@f.HtUSHuct"t) {ta\H[]DzyH[]1fD1zx#~ fDH[] 11e1Rhf.SH=11迀 u [fDÉ15z[饃D#w8lH5H1fyHH1[HcٓHFfDUSHc߿H=(HʼnuH@HH[]fH(HHE1HWzHH[]f.5.,t1 ,u',u*H,Ht t' t" t,fD,u@H@@H=a,HtHHH,HfD9=*,H*,HEfHH=*,Ht18u*HzHh*,HEHf.1f.HHHG HGHGHGSHH5*,H),H),H),H),),lwHxs&HHu),H),H),[@f.SH x C {x CHC[ff.H=I),G x9tSH譀C [ff.Gx9tSH}C[ff.G GGGGG GG;=(,tfD(,5(,(,(,f.ATUSH0dH%(HD$(1HHt#HH|$HD$D$衟uHD$(dH3%(lH0[]A\H;uxHc$H;H2_Ht%P(@tH;1H;dH,H9tHtNP(tH;HD$%rHD$L`L4uHx;$LHrHHHoH;P(uHHc{ H;11HILqHc{x H;1IH¾cLqLH HH1;~Hc{2 1HHHrHJqHBqtG Wx69tx>9t9G u xGDyf.@f.H=G&,DSHH x9t={x9tHH[D}CHH[wt$ o}C t$ f.HHt`USHHHWsxHc\"LH ZHHH1|H葞H; HH[]ofDATUSHHIH$LdH%(H$1uL{Hu1HLjoHC$+H;HtnoHVH1HHCHCHCHC HoH$dH3%(u H[]A\lrff.Ht fD@f.H=Y$,@e$,uDH=9$,@2',t@;f.AWAVIAUATIUSHHdH%(H$1snIċ(V,1H~,thyH5 Hź1pHHH1蠽-,H$dH3 %(VHĨ[]A\A]A^A_H` 11HwAL|$LrDIhzEA~AHcD|$#|$!ANHfDAƀ t PHH9u߉L譳HIpA,$HcA|- H51~oLHH1gLlf.A,$H4=z,ݺ'11HXvAs9-UW:5OH,@ t H@H{,1l=,,,,,_,,,3L 1pLD`0IHcITITHuHҢ,I]IEIcIDIE8-=~,1H=:,u $H<%kCH9h,H=, kH=3,>H#,D%<,L-,L5, 4H= ,tHL$HH $oDHD$wHt$8H $H)$GvH5`Hź1AmHHH1~A$EA9 H)HcH%@A<HDGA@ H9uLHc]HID(^(MD(H51~lH^, HH1Gl1+rHIEfAWAVAUATUSH-,dH%(H$1-,HIV,,AA։MŅ,}AGD#,L=ص,EۉL$twH@I#H @H9A[ AGAA<EA _HƯKA@E@u -,LDD$s,HH1HHt$HHHt$HhDH"DD$EBT$肍T$B#MDDL% ,=,B@AtBE1|AŅMgtA $W,=|,D$|,HyH,AD$-,t=,t+,H‰,L,A~u@H=,HtfL5,1HLHHLHagHz,e=ҝ,tL‰D$,D$|x,A|$wo,D$|,?,&=s,D$|),aH\$(HPHHlH|$t H|$ZH=讚$|$$tt$1D$A w |$蔨D$,ezH,f.-,H$dH3%(HĨ[]A\A]A^A_AG}@E-,Lx,HHD$gHxHt$HeDH…;E1DT$D ,T$Ey ;1DT$@ET$:D,EtRy1,n,L,HHD$?gHxFHt$HdDH.W苭'fD=,EEaLDL1H԰,SDMDDL5!4fDA? Aƒt EAMƒDL E!‰D @,=,fDLDL%*IHtT$T$x,@=",+ DŽ$IT$D$T$ H=,HH|$(? T$$螧H=w,HHD$(H5[,HX,T$$HHt$c HD$$H|$T$8OH= ,HHD$D$$HH,@T$8@D$C- HD$Ao, ,{ AD$$ H HcHByAtBE1赇AąMwtA=,D-,H5AFH5,Dl$|D-,e,t=,t+H,H‰F,I~T,A赇u@H=,Ht`H1,1HHHHHHaH,蜃= ,t&I~Y=ۯ,HHhH;HHH$HHT$IHCHT$D-p,H;tH/`H'$D$D$|9, A |$ D$t },D$|S,,D$|,=#,|$<,tE IGHxt HtOMD1D$`AOȃD$IGP|&;'|$tHPHtJH@HtH,,,IGHx,,tLIGDMDHxT-,EDD$$T$D$$MgtA $I|$5D$Qn,BD$|,D$xD$tBPD$ItHtAGtGMDD,U,tAŋD$|,fÃ=U,tDl$uAD$t:D$$u3Au-D$t%t!,,,D$|,1 D$$U=,t=Ȕ,u =c,u7,D$$(AD$$|$D$,q=P,LIt1D$It1D$I_t ,HŨ,D$DC,=,tHAuI=#-u@H=4,Ht*\H-{,1HHHH=HH\H,~=S,tEH{1:1HHHFHD$HH=M D$HtLl$H=1L^LcML|$8~,t =t,שu,tI\$Hu(fN,HH^H{1;0HItH@HtH8Ht ? H߾,D Ч, EEtLHOHAZLA,T=,DI_t H{D5,D_=,D$X=Б,K,UI_t ,D-C,tHC H=^,kHaH,-,t=n,t+,H‰,L$H{L4k$J!,t D,Eu4M},t =s,֧t,tH{ ND$L,t =B,襧C,tƢ,.,t ,uRH{L-(,qjD$Et+H{L- ,RjIƋ$D-,D$-@,D-Ր,I_t H{-,O~-,x,)t =h,˦i,tH{Ht tO5D$=Io5v,H]H=[,tH;:H@H;KHV P(@G D$HH51ZHH1P3\AD~T$DQ-EH=a,Ht WWT$H5,T$HHt$[ZHxb Ht$HXT$H,T$yH,H3HH=,H,HtoḤ,$tH|$0VH=裋A,ET$親H$$"H=FHHD$0.H=W H1DŽ$T$H9,D$$HHD$HD$(D$C6DD$HEfM$$MSI|$HttOAT$u҉D$Шt M$$M?L|$8H|$UH=B 蠊D$Dʍ,H|$|$CD覑HuMAGDLT$$ҞT$$r=*,T$$艣T$$K*$$$9wH|$0TH=׉3HD$(H2HD$D$CH=T$Cu|$$T$Ct%Ht$(H=1T$$R@T$$Ht$H=1T$$-D$CT$$uMDDL,BT$zADT$ED$A_AljAރAD=,ED$w=4,jEah"fD$L|$8H=uT$$1PT$$$H|$0UsBE1yA_T$AĉAމ׃ARAt EAEED=,1 (E,,D$|v,,wD$| ,H=1ɾ豨D$|,D$ =,|$D$,,gD$|,D$ pUD-,D$Rt =?,袠@,tÛH{HE11MD$HCH{,L C, KH=-I螆H=1L荈tHCHML H{D$ ,t  ,u" t,t =j,͟k,tܹ,& ʹ,t, HmH ,t =,s,t蔚CH4,, 5#,tH'A}wuT -uJH=,HtPH5,1HHHt$HHHHt$HLQHe,Ps,D$t%LH,BHt@)ueHE1LH06fH1 P(@A<$I[A|$FOA|$SCA|$7H觿*HD$HEH8{HL$HEj H01HnLs,Lƛ,D$8AD$,2=,tLQAvuI=-u@H=3,Ht)OHz,1HHHH<HHOH,q=R,tID$I|$k,HHD$PGIH1詓MAt%MtLD$8Ɔ,H;H"NHuH;MAOMDLD$_HhH|$EtE€=,Uu =,u=,uEDMپH‹, , EtEIGHxH+|$tODMD[  EHxq,HtOc D$a,_,IGP !-,)Br64,MDDLAop,tyEAD$$1D )E\ E,D$$2 D$H 1H=،HH=q1L7A$t ID$HLt$Ld$HL|$HD$HH=3@b,)AH5HHE,Ht$Xo,H=@HPt 8RHl$,E1ߘ,HEH8^HmA9DLHuA Dd$hA~H1ۀ8|D$hAtЖ,t$dAD̓ A~8cA~-A~'A~E1AAD$DDd$`9l$DD|$D1EEGLd$D M$$MuID$H=@,HHQL Dپ01D\$|HTID$H8.[ZYD\$lAADE9~kt$dD$A9~< ,DH5,ljؙ9~+ @L ,ؙ)A9DD\$`3 L1H5, KD$DWHD$Y,L-,D54,H=K|u,-HCHlBnAoD$M,L(,T$8t$DDDtEAD$ D$Du>Et9|$8u2,D-,$,,fk$m,@ I=,<ED-,\D57,t=~,u =E~,LH=3{-h,D$Lt$L|$D,D$8L-:,~,H={l$n=z,ݔPLt$L|$t=},u =},L?HxELH<H-A|$H|$HHEDHx@|$Hźx D$E1=}1=H1H޿c;DDhC1r,tDPPH$(dH3 %(D$unH8[]A\A]A^A_Ë|$&H|$HH1ҿ:LD$L$T$HH=q,nBH=r,bB F&>fDAWAVAAUATUSHHX,Ht$ HL$HDD$,H=|#Ht W,9H,u HD$@HL$8H=:am+,H=K,}HX[]A\A]A^A_@H=dkH,H;1C[H=|L1BmH=[112mH=n,nH=Һ,pnH=a,_nH=ĺ,NnH=׹,=nHt$H=A1lH=,nH=΂,nH=i,mfH@H$YLpnH@HD$fBE1s[ CHD$X[!C[H-HD$(D1A"rH|$0vtl,7[-fD",zf.D\$8EuFL|$(L7HxLHH5H=H1qkH=QH1`kCVS,aW5k,Ått{,DfLD$HH|$1H-f,P,H-P,iX3,H-8,HD$ H8Y|$8HD$@,l,|$<1(Y XfDH|$6HxHt$HIm4H=L1LjH=PL1;jfDH=Z11 jHH5ѓ1%6HH1ւ,|fATUHS IܼH=qHgH=H1iHLE1E11HH߉茲H=1g[]A\fAWAVAUATUSHHXH|$t$8H$H$T$Hu+1HT$dH3%([,[,HuH[@HNtɋ$&f.SHHdH%(HD$1Ht>Hu+1HT$dH3%( p,Hu!H[f.HHNtɋ$J&f.USHHHc蚼H{HHt"HkHH[]Ðf.SHHH5Bp,Mu H.p,1)H,H[Ðf.USH1H(H+q,Ho,H H{HHt)"HkK(HH[]f.CtH!)H)(f.{f.p,t@gf.f.ATUHSHdH%(HD$1H=n,t#HL$dH3 %(Hu]H[]A\H|$N^T$Hn,Le~1Hn,HHL CH;D$|V$fDS HH1+H+h,rn,t "_n,H[fAUATUSHHt^G)ItXHHtL?tGII,$1HHt/H@H-n,Ht@)tAt$HxHt?IuE1HL[]A\A]fL-m,H[L]A\A]I@u"@u@u'Hu[#fDGAWAVAUATUSHHHT$ Ht$H|$8HD$0D$,HD$8H\$0HL<MH|$ D$HD$I_HHЅ|$tutqHT$ B L2D$(H DHAMi)HL$LAHfDDII9tdKDH0D:.uH|$$ufM?M\H\$8D$,D$,HD$0;CHH[]A\A]A^A_1fDH|$ W9~DLcd$(M?HT$ MAD$B KKDfDHl$ rBLHcEHIHEE D$(ÐHtG t HuHu f.HwHt/H1觖H5ߢ H¿1H&DfDHff.USHHH?ty ok,Hj,H*H3HHDJH4H; ;k,t=5/k,Hcэ~9̓Hlj5k,tHck,HVj,HT,DHH[]f.Hff.AWAVAUATUSHH(:xL3HD$MHE1nLHxLHdIHL$IcL,M;~t LHxLH3IFAHLsMM~MuAF(DuM~MtM9~nIEn(HAHD$E1A?Ht*AAtAAtLIDEI|)LL$IHt$HBASH_FUNMU IEC_HfAEL!%%HLL$fUHE=A?EDHD$McJHHD$H([]A\A]A^A_ÐIv11IHD$ŐI|)LL$!Ht$IHHL;!E=A?LL$rH}IQL!2Hi+HtfHGzHP+HÐf.HtcATUSHHtOHoL%( fH H]Ht)H1LG#C(tHI[]A\fDHWHt7StPQ,Ht-Hu9HS[H5 1"fDHuuz@unHH5|1P"H#[ XHH55 1"C(tHf.fD[1p[1HtKSHH?Ht4HfHH{HtG)uH$H{Hu[f@f.G(t D@f.Hgٜ,t9e,D$ H +5e,HyAHu1BNBN^E¹^B HEH +H@HHHHiHiH)HiɧAHщ%9tfDD$ Ae,g@USHH2Hc%e,DH{HHtcHkK(HH[]ÐHtKATIUSHHk 1LH_HtH@H-d,Hu H[Hu1[]A\f.1f.ATUSI,ttHBd,HtPHk 1LHHt*HxH-Od,HtG)uHGHt[]A\DH[Hu1[H]A\D,tfDHc,Hl1HLcHVHxHc,HuADLHHHmHATUHSG)HH? ,1Iun,ub,1@H9tEL9t@Ht_@)t'tTHxHtK?tF D,1IąuH[]A\fH]H5x1HH1e[1]A\1fHHt@)uHfHH@H1Ht@)u HDHH@HH5%b,PHt+@)uHPHtHHHHu1HfHH5a,HtHPHtHHfHÐf.ATUASHt_P(HtEHxHt2?t-Ht(P(t t*HxHHt?uEttH[]A\1H[]A\fDHH5 a,@Ht+@)uHPHtHHHxHu1HfH .,1H`,u,t&1Ht@)uHÐHH@_,1@SH=MHtHxtP(рDщP([H=9vH`HH鄂@HdH%(HD$17Ht"HxH=tH$P_,fD>_,HD$dH3%(uHff.HHt HDH7Df.HHtw,HHBHwHt=O,uF,#Hs,H@f.SI,0Ht+HXHt"lI,;u# ['+f[II,HXH,E6H|ff.AUATIUSHdH%(HD$1^HtHhHHt}u'sHD$dH3%(H[]A\A]H HIH$H9t8u DG@u3H[H5v1HHL1_f.H5P DHtHDrZH[H5`s5DATUHStH~HXHtuD#EtlDHADPt6S.tmDHt#{uECDBЍP vrfH5v1=HHH1^[]A\g+,f.sDpt{~E@CDAD[]A\+H ,H\,u,t+Ht@)u HfDHH@[,1@ƃDf. B,1u,tP>[,1@=f.ATUSHP(ItmHxHt[?tV ,1u,uZ,1@Ht'P(tt&HxIHt?utt L[]A\@E1L[]A\f.ATUASH,Bf HL€ , @H7Ht2<,8tPt@<,t,H<,!<,^,#HfDH=kHHt8u+HfD 1H ‰y+H@SH;LHHu{At&Xu>,t ,[WfH71Ht8u HfHǺ 11 HffDf.AVAUATUHSHHdH%(HD$1G(tWHt$Ha{HNjD$omHHL$dH3 %(HKH[]A\A]A^fDu3Ha>vHfD>H> HxEHHIċE(u 1ƒL1ULH;DLd$HLozL$HŅ}LHUzT$fH|HIwE18At)A}A}LkLcMf@H;t{ILLLIHK<4HDCHIE18t*A|$>A|$zLLcIm;t#{{HH@H谶LHHRJ|-HE膶IDH`HxgHH H@LHLHIDAE1L- E1L% $@H?AAo{u9IufAH1HI5AAA.LL@AVAUATUSW(HIЀG(HG H@ub1HH{Ht HCKR,C(t$C(Hi+[]A\A]A^uH[]A\A]A^ÉH1HHHS I9tHH^rfAՉPIĉ0tSuH{Ht Lc01L-uLEtK(1KH;1L#.t )O,L3t H5e1LH1BRjH5h1LH12QLzEu1@f.AUATIUSHH;HHxHHt 1HCH{Ht[~HtVHFHCS( P,ЃɉC(tЃ €S(t +H=+莒HH[]A\A]HCfDLHN,HxȲLHmH޺HLIHIE=fDAUATIUSHHkHt&HHHHH[]A\A]JfDLmHHE|JLHLmH-cM,HxLHHH2HXH[]A\A]Ht[Sw(Ht4H{HtH;C(t >+H[}DH_H{Hu@@f.@f.H5L,S1HtLH=e+HݐH{Ht G(uIH{H1[@+[fH51L,S1!Ht&HxHHt[~H{H1[ø[Df.HtsUSHHHDH[HtGHs 1HHtHxHXHD$:HD$H-HeH1[]@H[]@fSHpK,Ht MK,DC t9St H[Hu[ÐH{ HtuHC [fH5YH{ HC ֐H59@HATUStgIHH1@HP Htz H@Hut?HH{ HL!H[HuH]HH[]A\@1H[]A\fDUSHHcJ,Ht>Hx t4/H=HJ,HHHH]HHH[]@1HH[]@SHHH Hc[Df.HH5I,HtHHD$HD$H@1ff.H1%HtHHD$sHD$HfH=HHtHHD$>HD$H@H=T@H=D@H=4@USHH I,Ht#H,C t9St4H[HuH5b1HH1J1HH[]fHS Htz ttwH{ H5HHH]HHtHXHH[]@f.H=d@AWAVAUATE1USHH(Ht ?H=2HI6H8,Lx1LHWHxu蘿HD$IEHIc1HL$$f.A8EIIGHtFEL0uLI2Hx9KLHljL$Ht$HIGHc\$HuHD$HHLHD$H([]A\A]A^A_@HT$LHPeuAAAHD$DHD$ofDSHF,Ht#1HYHtHF,H@[1[ff.H=QF,Ht4H5H$H=5F,H%F,H@f.AWAVAUATIUSHt$1t'HcA|( kF,ɉL$ L-E,ImQE<$H1L4H$f.HL9tgIlD:}uH$HLuHT$H.E,L$H[]A\A]A^A_HE,H[]A\A]A^A_f5E,F9D$ D$HcE,HD,JL$HD qE,H[]A\A]A^A_fDItH=[H€DfLXHx_LHI'@L0Hx7LHIS@H=)D,5D,+HD,H-,1AUATIUSHcLcHHt_:Hu?LǨLIHiI<H]L1HC,H[]A\A]Ðzt*zu4LcfDLpLHILcf.H8IqHH=YHItfHHItV@)tPHH5X1HD$Ht$H1BIHtAg(IGL1HHDHL認HHC(SfDDHHIf.@CfHDHbHf.H>,L9` OH;wHHt~C(%'Hf.1f0HHfH{ϕHC(|H1gH1LwHHl1@AUATUSHHL%=,I\$ HHuH}1HA H=,H9Z H=,M( H9Z HtU( P(H=˥+LeHtnA$L-ƥ+@XII}HtK)uLuLHxHc$u,L-mt,LHǍSu,yIDHH[]A\A]fJ Ze(G@L;%<,tHID$ HID$ H<,HX @f.G(%0=0AUATUSHHL'H=+HtmA$L-+XII}HtK)uL`uLHxˠHct,L-Ms,LHǍSs,YIDHH[]A\A]ff.AWAVAUATIUSHHt @)HulLE1HHE( u]AAtm \;,9M,sH D;,H9 ;,_IE(HL[]A\A]A^A_@LhE( t ;,9M,It%AH;,Ht:,C t9Ct5H[HuH5 U1E1FH1<qH{ mH|E(@tLE16@HH#U(HHs LEIE(AE((:,K  AE(AU,A<$IE;,AM(f.LuAH5S1E1JLH1=rLXHx_LHIECE12A|$FFA|$S:A|$.L[!NHHC Hs LIŋ@(fUSH3HHt+@(u$t@uw]s(H{HHK(HkHH[]fDSHHt p(@@t H[@Hx1K(@HCH[Hy8,SHp H\K(HCH[f.AUATIUSIHHfHtH[]A\A]fDHLhL` t h(H[]A\A]@f.H7,SHp 1HK(@HCH[USHHHH=7,tBHHt H[]fDH7,HHE1HP H[]l@c뷐AWAVAUATUSH(L=C7,H@H|$Ht$T$MH6,H@t}H|$1HHtYH57,HXHtIH{HtfLt$LyHx耛LH%H{HCHt 3HCL=6,ML%6,fMMAG tI_ H|$1HHtHhH6,HtE)u.IW DD$1Ht$H}H([]A\A]A^A_'MHMIv HL9Ht @)MHtMvMuC)L9tbMHyH5,DD$1Ht$H|$HP eHd5,H@bDH]H5IK1HH1l8HMIv HL9tWHMEMvHEMuC)H{HtZ1yt6H{T$Ht$H([]A\A]A^A_]DAD$)\LIU H{1DD$Ht$tIU DD$1Ht$H;\fDSH=JH dH%(HD$1Ht 8HD$4, WcغQD$)B0kdD$)HHcHH\$HHB0D$HHH)Ã0\$Ht$H\\$ۉw3,af^3,05H5M1H161"3,\$D$Ht$H=I1H(h+HD$dH3%(u?H [f.غgfffD$)B0D$)Ã0\$0z@USH=$HHH=,?HXHt @)tHhHt}/GHt,}H=H聿HHt'H=>1HH(r+HH=>VHtHxHt cuH=>11H(H[]Ð,uH5.N11HZH߿H=6>1HNܙ+H(iH=>H@) HhH}/H5M11Hu+fDH5M11HmDHHHt H#H=\GHf.SH dH%(HD$1vHt$ Hc |H=(GHHt`(H=G1H+H(HD$dH3%(uH [Lff.USHc H(Hl$ dH%(HD$1Hc|H=F1HHc HB|H=D1HHD$dH3%(uH([]DATUHSH1_t11HE1HtP(AԃAP(H1H~HHt;C(ƒEE‰€S(t H5J1HH1s2H[]A\HAmHtP(AԉуAH(uH1HHy@H11HIkH^SE1HH H HdH%(HD$1`HHHL$dH3 %(uH [zf.SHHtP(P([H5 1H0,uHtP(P(D%( H(H=.,AtH.,1HP H( fHt$H|$T$DD$Ht$H|$ff.H=-,ATUSHt ۥH=t-,H-,1HHtHJ Htq HRHuHt-,Htp HM-,HIp 95-,-,H11HH-,HC H#-,HCH=HHHt HHI}MtLH;,,tH_.,te[+]A\fD5*-,腤H,,Hg,,H, -,HH,,HX1f.H=HHtHHHHkH([e+]A\f;5,,T~,,H@f."+t@f.S1HtX(u [ޓ+[f.Hu HfDHoDf.SHH?HtH{ HtH5oH{ H[SHHHHX t S u#H H*,H*,HPHBH[H5I1HHD$zHD$SH*,H5lEC tBHCHt-H{ H@H*,Ht H5.9H[H5iE1[H1,fHI*,SH9tH_H0*,HH9uHx H5MH*,[H*,H1@USHH),C tmHCHtH@H;H),Ht6H{ HttaH5R]H{ H H=?HH[]KfH5D1HH1[]}+DH5qf.HcA),5?),SH;),J9|) Hlj5$),HcH Hc ),H),JHЉ (,Hc(,HH(,H[ÐHuHT$H<$zHT$H<$z(,Hlff.H(,Ht (,u Hf(,HH(,HHݱf.Hw-',+H==HH3JH',Ht Hc',u HH<#VHc',H',HHAUATE1USHH==HHt @(H==E1vHt@(u[1Ht$@HCLHHMHHuHXsLH¾HMHH[]A\A]cLhf.L`rUSH===1HdH%(HD$1Ht@(uqH==1Ht@(uP1Ҿ|NHHtHxH(uDH$HTMHD$dH3%(u^H[]DHxfHXf.H<$~f1ҾHNHLH$HHH$%,AVAUATIUStsH=+HA,$1L5ݍ+|HHHI<HthLc)uLuH+IL[JD(]A\A]A^DH H=z+%)%,a@[]A\A]A^Df.AWAVAUATE1USHH/t$1H>HHcsHxzHHIH؀8=MH~$,Hm1HL@H/H$,HXHH{HtMH{2$,K(LcHC,t HCLA<$HE1I|(LD$躈IHLLHE=A<$LD$ET$L{+$%,L.H[]A\A]A^A_f.A|$AeA|$ASLIC@H5)#,LMHIJD+18+uL1HIL0AG(@tWtL+,LSH1[]A\A]A^A_f1LL~;fLJ|+1褫IMLLLHIDH}IPLU6HH!,zLcHItC@(MINJ|+1MwIfDJ|+1MɪIFIf.HAUATIUSHHDH[HcHs 1L%HHtLhMtAE(t]+ uYLHxLHeH}HyHqLHHYH1[]A\A]@ ,A9M,uu%I}@Ht AE(I}IE%= HAE(t IELc I]HHxHHL1HI}LhGH}HH1[]A\A]fH[]A\A]GFfDw0H5,SHHt@)uHH5,[DHHt[H5s,H8SH藾Ht@(uH[H551H;HH1_![H5,SH@Ht@)u1[ÐHH5,[pH5,SHHtHH5,[K1[@AWAVIAUATUSHhdH%(HD$X1MM'MIl$M tIIXC=u=HL)Dt$HcM,EAEuD5 ,EuA<$B D-,t A<$S(E11HLHHOLOM(EtM(+AE=E(fDIMgMH5T,H=NFH59H=H T,H5K H=9GP,DU+EH54H=,1H5RTH=31HV?H53H=3#H5H=3H5H=3H5,H=3D,Et,D k,HH3H5E3H=3EHEH(H5FH=J11H(13H5FH=21=?,}+H,-+H- ,E HU HsH;E11HŋC(Dt&H}HtPC(H{3HEH,H;,H Ht.C(H E(H[]G ZH;HH[]HVUHE H2,HP 8H=R €H{kXf1詽HEH ,H; ,=c(5DSG(HH?00tH[h%Hs1ɉC(H ,E1HP H x ,H9 i ,tHtS( P(H[c(Df.H=;%H`Ht+,u H=S%H=c#H饷D+fAWAVAUATIUSH= %H(dH%(HD$1H0@(HhHE9HLmAfDMmI}Kc|XIEDI9E9~MLcLl$ Mw)L IKc< LCXLHH5L9MuDHD$dH3%(H([]A\A]A^A_D~DsLl$ 1IDIc< LWHHHH5I9ufDH=#LmI]H{ֽIc<$WHCL@Hx2Ic<$3Ll$ 1@ LCWHHHH4IcAH $~ɋ,Lv u$H51DL$ DL$ H $IH= +HH[18SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$1dH%(HD$1=k+dmH$H=u+HHھ$HD$HD$ D$0HD$wH5@+ |,u:H51ɵH=+H¾13H=+G2HHt.H5U1肵H=+HHپ1H @f.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1wH$H=+HHھ$HD$HD$ D$0HD$H5+ 蹶,uHD$dH3%(u'H[Ã=6,u  6,=6,賴SHױ8 HH=(? H[1f.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$1dH%(HD$1:H$H=+HHھ$HD$HD$ D$0HD$ݰH5+ | fSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1gH$H=+HHھ$HD$HD$ D$0HD$ H5+ 詴HD$dH3%(u H[˲f.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1wH51ıH= +H¾1.H$H=+HHھ$HD$HD$ D$0HD$H5+ 萳HD$dH3%(u H[貱fSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1gH51贰H=+H¾1H$H=+HHھ$HD$HD$ D$0HD$H5+ 耲HD$dH3%(u H[袰fUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1[1RH$H=+HH$HD$HD$ D$0HD$^H=+Hi H1ѷHD$dH3%(u H[]袯fAVAUAATUISHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H=M+HŅ>58+D5+EL Yn HH=+H_AUHI1ӶZYH$H=+HL$HD$HD$ D$0HD$蔫H5]+ 3+HD$dH3%(H[]A\A]A^Ð8DAE1ID+L%+++HD$HdH3%(HX[]A\A]A^A_Ãu _/fHEBIu<_tA[LuD$8 AH\+H=[+Ht H9HLdHxkVLHHH6+E.-%+L=.+D%+D- +HD$H+H+L5+++HD$H[+HD$H[+HD$ H[+HD$(H[+HD$05+}HD$-+D-+L=+He+D%N+Ho+HD$HC+HD$Hg[+HD$ Hc[+HD$(H_[+HD$0H[[+AEv =Eu||$8]H詏HHt E) =+|$8]9Hi',\,@+fD1H w+-++L5+HHvZ+H{Z+H|Z+HeZ+8H+|$8]HD$@HT1Ht 8HD$@H-Z+HZ+H Z+-+HZ+:HHqH4rfAT$wf$DOA)A4Hh=11LܼLcB|]NtL%Y+D$8]E.A@A_ADH=+Hst$>(E,$! U+H# HG11H>H1??HL$@11HAAT$Aփ@XHA))5>@ƄtL@tG +11H:HH!$,HHc<@DŽt0@t+ K+zIl$AT$A{<<>u@tA|$=tc +&um<&ui +H5r 1襡H=+ Mt$ ++ Mt$ |+|u <|u c+H=G+*u`<*u\ >+mH51HH=/+E`H51ݠHuKՀu8<=tr +uYt:u/wHਫ਼uH5& 1zHH5; 1_HIH="HwB+ D+ n=3+LtEHt6tp@v< uHDJu2<_t.I +'% -ۃ-t + +fDSHË+t4Zf.H ؋u+g+ۃu(HtӃ4+-#+f?t H[fDHtkV+:=+:H++tm/-+H+ [f++t3:t.@-q+=+:u4}+t HH531DHH5%1)HAVAUATUS-%+HÃ=t tH[]A\A]A^@=+@L%+L HxMLH觛L%R+HHHx4Iŋ+uILLHHR+L%m+Ht L9L_HWM1HH8+[]A\A]A^D-)+TLLHL%JR+HIGA/A%tXHuS+hA*#A/A+TA-A*&A/>A^!A|H @HLHcQ+HhQ+HiQ+HRQ+%HLLHE}A ~tA%A&HH!(A+tpA-(H)A A%A&DA H@HHH1DHH9uLHuF1A/H?ifHVfDA^tA|u\HHzA/HEHA u%?H51萚H(L萗H5~1mHH5U1RHf.H=H+,ufDs=/+,tHHSF;Pv< u)H@HJv tދ+Hb+9XHH+HfoN+HP+@8+foN+PH+@HHPHp+HPHE+HP HB+HP((+P0Hc:+J 1+H .+H=HxDHHHH"+H+HH%N+HN+++H+H+HM+HM+LHË+H=|+HtzH=+Htig+H\+O+HcH+L=?+D5(+L-YJ+7+HD$L%OJ+H-PJ+H1+HD$H+H$H:J+D31H+ H+HfH+HH=+H{fDH $H-I+L=P+D59+L-gI+L%hI+H|CH lI+.+*Hŋ+uH5II+Ht?H=$I+H|H+DH=+HH=+HH5t1蘓H0H51}HDS:={+ HuHfDHU+t/x7HڻDtHHHu=0+ tH[ÐH[H5^1Hf.AWAVAUATI USHSID=+A/@A/vHL[]A\A]A^A_fA%MsL5+uA*u~fDLf+Hu;=+taA*tfDLHՐA/HEIHI9ut{HuE1/tfML5+t7At/< t< u'IMLtZAtII< t< tH+H51芑H"@ HHD7L5+Hs+봐USHeW+HōCՃt)BfHH)ƒ-HD5+'+CՃuV!+uHHH[]fDUSH-+HÍEw9@ fHH+HH -+HD؍EvHH[]ÐUSHH)uN|H9@@[+Y+CwOu"H9@@DHH[]fDu H9@@륃 ,H|T9H+bL +1AaE1@rL AHE J4Et DLcJ4uӋ ,t cHcHƋ,t swHcHHDf.H8H +bH5+H1yH6@tHcH@u0HfHt3H+bH+fDHHH7Hɉ2ufDV+\+6+0+*++ +++++++++|+++++~=+|=++d=+R=+(+Ðf.1baH==+L6+@HHA@4HuQH<+HcoQHcHc;f.@H9+HcHH׋Ot47HcGtLcIBDHcGtH4HHGÐH ,4@f.HtH +Ht)H @HH9t9xut xtx uÐH Y+Ht1HHH9t9xutԃxt΀x tHH9uY<+~bDHL6+E1IKEHt;H@H fH H9t(;yut yty uHt%Df.IM9uHt 11@AUATAUSAHHH$HdH%(H$1LjHH貈H1H耂Ax:IcH5Y+EHHL)HƉHtD9jtHH9u1ҿH2H$dH3<%(uH[]A\A]芅f.Hc ;+9:+=:+H+t9tHHtxtVHcHH‹@t[t=:+t:+HfD:+:+HfDHcu:+w@nuHcR:+H#+HH׋@yff.=:+t& :+tH +HcHHtztJf9+tH +HcHHtzt$HtHfD=9+uH9+HÐf.H=Y+Ht Z+u HgH,+H)+'+HfLc+H 8+SI9L+A9EH,H@DHH9uH+~ HcH9I9ȋ+H=+HcH42 z+Hg+9}2HcHHHHHTHD@HH9u=3+1+"+[P+9Ɖ+1EDHAUATAUSH-,AAHB9DtTH5+HcHHDjJcLfZ B +tHDBDHH[]A\A]fDHHHS+@7DH9+1H 4+*+H, tuHcHHH;xt+09u@HcHH9xt9t+ƃu1HÉq-+H=1b1fD1H=HrHt HfDH1+Ht +uH=+)H+HHHEHDf.USH=8+|H+HtH-TH9Hj+H56+HI,H9tH5+*+~H[]CH55+HRI@,H9t{H-{Ht1HLn'+H+H1HBH< DHHHt zH9HuLS'+LcMWM9T'+DHL-+D%+1IfDHI9MMtAxuEug&+;PtIH1HHH9u)HcL9~[AH@~LDHL+Dj+1I fHI9t'MMtAxuEtRHAHI9u@1H޿qmD@Hr1HHH9ufD%+;PuyfH=%+y1E1HIyH%+ A hpH%+uff.AWAVAUATUSH(dH%(H$1H=+FHl$H$HrHxHxHr1HHZlDO%+E1E11L5_f.H;%+L+M$(MtEL$Au҉++AAD$D35u$+>tH=1H;$+fH=+H$B1H޿[kH$dH3%(lH([]A\A]A^A_f5#+u Т+uZN+AD+EuAJ#+9Pu/f. z+fAEL$rf^50#+t?H=1@+=H#+++Dr+i+@A"+u+>fDD+DE*B<>t+ t&׉T$ 躏XL+T$ I(DHA  H5Š+HmAt)H5a1QlH=+H¾1tH5+ ZnH+L$(EL$UDH5Y+ /nM H?+1H+LL$(I4$nAL$|@At*B< M$(EL$Au=!+tMH+1H6+LL$(I4$nEL$|@AnLL1IkH=[+HL1ysHʷ+L$("DH-+I1MtH+I1XM:Hp+L$(ILWL1IujH=+HL1rD%+EDDRH511I,jH=u+EHL1rHY+Hζ+L$(EL$(SjfoH!)+foH+)+fo)+fo)+DB+DHHH@H@f.ATUASHHH$HdH%(H$1,lH_rHlH1He0H+EHH+H+HPt H+z+1H޿+eH$dH3%(u H[]A\hDf+t@f.AUATIUS1HHfDH{L#HtGeH߃L9eM9uH[]A\A]USHHH$HdH%(H$1jH$qHjH1HdH-+1H޿Hk+dHtH1H$dH3%(u H[]gDf.HH=+t=H=+ +臗+u HH=+iuH5>1fHH1龶@f.+t@+aUSHHH$HdH%(H$1iHoHiH1H_cH-+1H޿H+>cHtHH$dH3%(u H[]fDf.ATUASHHH$HdH%(H$1hHoHhHH1bH=+H-t+HHj+HGH+b+1H޿8+gbEtHu%H$dH3 %(HuH[]A\H1eAUATAUSHcIHHH5+HAHt+HHAHH9+H9+H;aH{S)+{;H{ HtHa-~+Hcm+HJ+H<HHcM+H<H?D;%H+t D;%C+uH[]A\A]fDH[]A\A]DC! $DQHHx <byH5+HfH+a{Hc[H531cAt$H1H-H5N+HHs>+-W+)…҉-++@H5+dH%+L@ɾH9ȉ+tY5+E19t#A9t7yAHcH<tEi9ȉ+[f.H++7fDk@5V+@U+~9ME19u PHcHH+f.HuDux1uu81̥uu@1H頥葥yH]f.f+uvH+u0vvv,+H1lw1`w1Tw+HD@f.H=B+t!H5 +Ebx6#+u1HH=+_t111EԸ@ATUS+tYH+bx 1[]A\Ð+tD%B+ZH=8HcD1蟪DH=+|^t+ +Ðf.ƒ~Yf{ƒN@AVAUATUSH dH%(H$1|=m]AH$dH34%(DH []A\A]A^ALt$L$L\LbL\L1LVHT$ 1IƋD$ HL+Hcȋ5#+H ʃaEyu[9u[HY{t{ u1{\CuHD$ H+HcH H9Yu4@9tD]MAtHcT$ H+HЋBt]D1LU@_]Af.E1{#\]fDtKtFuuHJHDx u@HH9uBBB[z\HcT$ H+HЋBqXAUATAUSHH,HXHxHHUH=<H衉H=r+H=m+ߌH=8 +ΌH=+轌H=+謌H=-+蛌H=+芌H=+yH=+hH=11HH=q1HHc+H+HM+,ftEٴ+~CL-;1fDHVHxHHTLH iA9uH=^,H[]A\A]AWAVAUATAUSH8dH%(HD$(1HL$$p+L|$ D$D$D$HL$f. +t+1ۅu x +u@t+!,t-D5,Et!Hj+HtH;+(A^L'\D +AD5+EE~tAD5+EI+D 2!,Et-D6,Et!Hʺ+HtH;+ET$ 5O+Ѓt~у!+~Ѓt D$-_ +HT$DHHuHHD;kut$ DD$ 1=C ‰S|$$ +D +Lޠ+LcD +E1E11K4DvHNDH˃Ff.HH9t41{ ‹C <uEtăDDHAH9u̅<FL$9uED$D5+EDV@Dl$t|$+tD\$E(5+t, +t"H=ҟ+t+f.HL$(dH3 %(D$H8[]A\A]A^A_fEgSE^0P NDT$E/D$DP8Z+@ED5w+D+D-a+EH51QH1蟟df.=+U t$ DD$ t <G+;@=+g|$$vfDObE EDFEɉFtRԶ+tHƶ+D$|$@z+f=r+\+D$|$ifD5 +EoEhFD$5fDHF(F+HtH~0LL+K4~HF(u* ԭ+t ++u\t\Fu'fDHcD$$HIË@|$ s>D5v+LϜ+Et`+uK@uB+rt!{ <3耉X+++q+u[H5+H.H9tHH;5*HH+HO+HHtHcT$$H+HH׋@E+qH,HD(+Et{Hx+HtoH;*uf|$+eD Ԭ+,Eg=,ZH=,T# idD+EuJquAu7y <~VyEH=+Hޘ+i-b+uD;%]+t[]A\1@[]A\ +u@+t,@H|$ +|$ u HHf v+u@+t@H|$ kA+|$ u HHf +u@*+tl@H|$ +|$ u HH2fD٨+Eu=b++tH=+tu&@5:+t h+u؅t0H]+t w+t HfDH]f.H1+t 5+t H@HDf.USHGHË(*+'+u1x+H[]Df.HZ~+ubD*uHH5"迒H5"H+角H5p"H+菒H+HH5o`QH>@f.H7H5+HHqLATUSHdH%(H$1 B*u(H$dH3 %(H[]A\DHL$H{KHQHQHQHQL?K1LHE=*Ox!1L-*D1MDE(H1LD+#6HfDAWAVAUATUSH8Ld$ H|$t$dH%(H$(1LL$JLPLPLlJ1LL?D+Q=*t D\$Eucs5+L5hPD8 IMD1LC1n1LA 荖ͧ+O§+1LuCOxE1¢H5,1ҿn+5CD*E+u-+9*"5ܒ+%NDL$=’+Eu-9=*t%+uD+Eu1=+9OH=Y*uOH=@1+XsH=C+t++ +~  *5+7gXM nH5+HXHH HL$HH0H̑+HHHu>fDHHH9uHT$tp**~HD@L +1II4ɉHHVH HH9tp;Xu~@1L *H*5*HAH$(dH3 %(bH8[]A\A]A^A_DHI9bf*̐++@+ݤ+a@H5z+u X*j++H>W=*xrM*=*Hl$@8r=*HgEHtTLc%Տ+H51BHcH1L貒HCAWAVAUATUSH(Hl$L$dH%(H$1HEHKLE1LHc? *ן+џ+a+D-+MO+9,t?,E1_11HI dxuL+HcIx][v+t+E*u!++}D+Z ,t(D5,EtH+H;>*u H{A,L+HcH M EQAH5*H H9t>H*I+FL+HcH M EQHT$H $AƃH $HT$@NA6+LMVAA+t15+u'u=*1H$g+H$H Dt+EEHތ+HHrHfAtHH9"Dp D~H $Ds+H $EH+HD 4*EBAAH $`bH $u=+u9=* ~ =O+u'H $/bH $=Ĥ+4+++H؋+H$H5HH*:+^bs+D-o+rA*d+c+H0>a*Afě++-+An+k;8 ]HH9̣+tMtIG *t#H+HcHƒ*@*H5*HpH9f7}*)pLW+1HIȉHt>HPH DHH9t(;XuAycHH9u͋=2+蕈軃~fD=+uUt^+$H+Hz1L9H$dH34%(DH([]A\A]A^A_HB+H;c*^HUH=,B=j+͇H5Y*HH9AO ȃ<-ȃDϼ+Ń耀DD +,+=*1 v:+hD'+EH $^H $1LH $m81衄HH~*H $eH $:>H+H $H`=B+襆AG DM H +AAټA1=*1A1L7H5֥1:HcH1]H5*HOH9謃H*ۗ+臃H#+H@t=+x\.PBFAG <9-*tHņ+HB<111H $P$H+H $H+@H $Hw+H $HEMP;+E1q111H $#H1+H $HyrHS*+H5m+ H $9H=m+=H܅+H $H$H+H $H*<+H.9@f.AVAUATUSHIL$LdH%(H$1;LALr;1LLE511Z1IL(5MXLA-;L`AL;1LL4*~8H „+H|H1HtzHVH HH9th;Xu~91L4 l+t*uF/H$dH3 %(D%H[]A\A]A^DHH9q또Z+uQH +Hth=+t^5 +tTH+t=HcHH;X~09uHcHH;Xta9tkƃuA&H5.1A6HcH1Of.NDp EH=16f.AUATUSHdH%(H$1H$HDH9HK?H91HH2 *H+1@H9HHtzuBu1HDh}2+uc+uI3DIEA<$ :0*,觸"f{f=2+蕀1H1 *t +t/^H$dH3%(uH[]A\A]t15AVAULcATUMSHHH$HdH%(H$1u7H=H`71HH31H+JxDvDp1H޿1D;HA7HC=H61HH0AtH+JHtxtb1H޿0H$dH3 %(DuCH[]A\A]A^DH511u3AuH14fH3DAUATUSHDL+dH%(H$1EHH$H6HPʳ4D=b+{c+vD+=6+{1Df0H=+56DAWAVAAUATUSHcH8H\$ l$ dH%(H$(1H2H8H$IHHD$21LHc,HD|+HDhAAL$utEuoH51H+-/T$ H1Hރ{Ht$1ҿ1+H$(dH34%(H8[]A\A]A^A_3HD$H{+H`E^c+H 0LpD$ H5UP14HT{+HH@HGDI9IVH ڈH5HDHHD1\4H {+M6J HBL9uE,HH|$H0 :+At0Hz+H HQHfx u@HH9uAEHz+HBABuql~t$ 95*H 95w*H HHE@|$ ?H z+HLpHL@zB1{HĊ+fo+H5z++)y+*z+Hy+fos+H)y+Bfom+)y+AtzBE1|$ ܹHt$X1ҿh)foyy+Hy+)+foqy+H +y+)݉+foey++)؉+fDH^H5әH¿12DH5Θ11Hx+HDz1AHx+HBHI+H5>1+HH19xHt$1ҿS(X+fUSH#2* _+H=w_+Drw+*E.+,*5*=*.~*v*9[*);P*R*<12=5*;='**9=* 1 *H5 1+*H1v*:fD-d(d*|X5**(1Ɖq*1=j*5W*0=P*H51u)H1;y***=*C-t9*tDt&(H5a1)H1x*f.**9*H=]+u+~,=t*9t1'H5q=#*m-ٜ]+uWH=7*x\*H[]**+lj**,*CH=*ytH*H* H[]1q1Hþe+H޿pK%]*(fDH=~1.;*f. %5*1HË(y/**+*H511-'H1vi/H=b[+H*H51+SpH5+ pH5+oH5o=k*1Hʄ+%މ[6*fDAWAVAUATIUSH8Ld$ H$dH%(H$(1Lb)L/HM)H1L #H=*tV *@*B*Hr+JHLHHH9uD5rZ+H**EH r+HcHH|9rHcƉIIII)JH0fDH[@D訢A|$AD$twD5U+E!f j~+Aօ $9* $DpƒDIAЃ)zqL$  $L#LC)H$HHD$"HT$1LD95* $ IcHH=l+* $*i*B5*DRD$D$E11IE1ۉ4$5\*t$ A@H Ht(9$J EHH ED9T$ ADyMc/HI9uEEAOȃE9* *D*D5*~+ANMcJD)LHLDHHH9uH9H$tt$ H$t$ H_k+AD=s*D=f*5d*AtD*9D9}Ht$1ҿ%D5**EuHj+H8A R+|IfDA/LYD$E1LfH AI9uDD$EMcHj+DHA#D=*A45}*%8_D-*qE1A?L$ "*L$ *AUATAUSHHL$HdH%(H$1H&L1LH=*H*~^11xt$H9i*~;HLi+H(HtEu֋pz+u҉߾H9/*ƐEtC1LH$dH3%(uJH[]A\A]Eu~@H=h+H*H*Q:f.ATUSHIH$LdH%(H$1L$H1HL[Q*~H11xt#H91*~*Hh+HHtu׉hH9*1H޿H$dH3%(u H[]A\VfDUSHHH$HdH%(H$1H#H1HHu*~uHVg+H1HBH HHHt zH9Hu1H)H$dH34%(uH[]f.1w x+x+Df.w+D~*S[*=U*t(9j*9df+tt df+[Ë=F*=*-*Hf+H=*I1:1HoDf.M+u*u5*xB1+!H/=*yHþ5*x1H @f.=v*tH"1HQ1If*x&9| NHcH:*fH|$ î‹|$ y0* 9| NHcH*HÉ*אH5 /aDf.H=*4H@*|*Gt Hh*@f.P*GK*f.@S=?+WX}+v+`+6+t]^]ff.HAUATAUSIHHH<@t*<*uFu@uu0H\$hdH3%(JHx[]A\A]A^A_D1@IAHM_HL]HH|$X1HuHHt$`H|$PLYHH$Hl$XHD$`D$DmHD$ HD$PAMHD$2wH HHЃD$D5p+HENA*u |*ItpH< 豾IŋE*"AE*EIMHtHfHHAuz* HA*D5p+D Y+E DEEtAHt$DL_L9AtL At4H4$H@AD$AE1H|$X$ H|$P H|$` $DH|$Xn MHDHLD}(AM߃HH҃!T$H$E1Hl$(H\$@L|$HHHD$0ZHt$(F4t+t Dt DiA1A9IL9l$0|$HD$EW+N'=>+A<NA%@#A+EH=?DL$8DD$0DL$8HDD$0DE,DAD <{R<(UHt$ DLDL$8DD$0\$DD$DDD$0DL$8X=6+t!=**A@t T$,VHD$\$DHfHcI4 '=+lA<f.HT$LT$H1DL$A~D$ HD$TE1E1HD$(HD$`HD$0fM /L9A A<lEED$W#nS\JA$|$HD$D:t$@tHD$D: T$ E:]`|'"=;+DH5+Dc@E1 AŃ=+"DH5DHcM /L9A AfDDMcC<''Ht$ 1++D$ D$PT$T^HD$ ft \E1AHcNfD=A+DH=1Ds]fDLD$XHL$XLH)1LD\$DLD$8HLD$8D\$D(HHc@LD$XHL$XLH)1LLD$8AHLD$8HlE1Hc{P+rHD$ 1ɉH|$hdH3<%(HMHx[]A\A]A^A_A>D$@D$ fA~D$ L5D$ @A|/(:T$Ht$(LD\$8\$TH RAHHHcT$`|H|$X=NB+H|$xdH3<%(HĈ[]A\A]A^A_AAIcfDHD$HL$(1LH\$dH)HHHAIcf.H\$dAfAEAIcH|$0HT$PL$HLD$@D$8HDL$8LD$@L$HHT$PzAH\$dIcG|$\Du<(S<{hA9X@H\$lAHD$lfDIcHttA't<=e+~pH=Z<s/AIcHtuDtAIcE1DHD$1HLl$lH)HHsHuAjf.Ll$lARf'wH\$lAHD$lDIcHttX<'tT<\ +vIcH=|Ht <AIcHtu@Al$EIc@L$ Ht$AVH;HcIDrE1Ici|(wAFHcЉD$`|3HKOHAO@8Q'HcUD=+~eA<s1Hc%DH$HL$1DT$$DD$Hl$8H)H3HDD$DT$$HuD@8'=+u "+"σ@J HD$PHD$_HA< t< t $Lc$$AHDHD$8HtH|$ HD$ HD$H|$XdH3<%(HD$Hh[]A\A]A^A_Lt$0MA6@tLL Pv< u#Hu@t'L D)HEuфfHD$(HtHNHD$PHL$1HLHs8HHLHHD$kHL$ $Lc$$AH)|@HD$HD$PD$D$HD$D$0L4$H|$(D$DD$OH|$ D$NL$DH<$L 9A|$OH$Hc4@IcHH<$DHIw Ht$H LHD$-D$0L$@9ˉD$A9͋L$MȉL$|$u*|$Nt#L$@C|$9ȉ|$t9D$u@H $IcDLt2DMtEPv< u)LIAv@LHuED$D$0DH|$(HtaDkH $MIcH,u@LtHl$(LIAvA@HHuf.IcH,$@|$L4$u-|$Nt&D$@|$H9A9D$DH|$8t HD$8L$H|$ t HD$ T$HD$(HtHpH|$HH?h1HD$WLt$H=I\ HH ID$D$D$0D$+fDL%+HD$(?HHcD$@AD< t|$< |$H= Ht$H[ D$H|$8HD$D$D$@H$IHTH6fDAPv< \uAHIH@ELHu.yfAWAVAUATUSHHcHGL7HIHHMIE1Mt A}1#fDJ#L9HEIFH8M6ILMuH{HyHD$IHCH0HH4$H4$LHIMHHt@H9tMtIuAEIAFfLLLrMDAHD$H[]A\A]A^A_A}AA}A LIfDHxxHHH[]A\A]A^A_vHD$뇐f.H55d@SHxH+HHu"ˋ+1AHtH[fH5+HHH׌+Hf.UHAUATSIHdH%(HE1H+HHH)HItAH5:+HHLLHMdH3 %(u"He[A\A]]fD+D$$f.AVAUATUSH0dH%(H$(1HHHHD EHI= AHT$ 1 HAE1H1tPHE1&DD  DDHt tuAHD uD@D$E1;t?{At3{At'HHt$DD$uHt$DD$IHT$HHL IHcD$MHH4tI4$D&EHuH$(dH3%(LpH0[]A\A]A^f.HT$ HE1HHAA<v A B| u# Pv< | HuMH]tI$E1YD=1+HL$HD$~qDL uD@E E :L$G~ ~ ~LD$ 1LHfDJL$AD$HcH4;<A AA Pv< uN| HT; @x@v< u+H| \H։L$uFfDEtЀ| t <wDHct$HL1H)HsHT$5D$HL$%HcщL$H4x@v< | HT"fx@v< H| H։L$urDSHHH?ujHHH9sIH=+@q@v u <7ut uHq@v u HH9r@HH[DHttT$ T$ HsfDHi@ATUH-E+S1LeHH}HtHHH+L9HuH- +Ht*HEH8HHHmHHuHtH;tH1[]A\@H[]A\H D+1H<tHH u H1 +Ht@HHuÐf.H S1HD+HHtKHHxqHH[l@H +HtH HWu HHtHHu1[f.H@HUSHHu,H5.H HH;HH[]HHSHHxqHfHHQHt+t$\HsuStHsHQHHu[ÐAWAVAUATUSHH8dH%(HD$(1HD$ H +H|H<$H: E1E1 fD t1@A A HuE1H|AL5oApIHHD$ HD$Utuu Au E u E=}+~kAszH4H@HHSH9uHUuH|$(dH3<%(LH8[]A\A]A^A_ÐHHJHUlH$L\$ 1HL$HLD$H)L\$kHL\$LD$sHUDDfL\$ U(fAE1E1E1E1E1DAWAVE1AUATUSH(dH%(HD$1HHD$IeHxM$hnLIؿHUHȂ+1Ht 18@ʼnL-mLD$HD$H$@At^=+~~ADH4L f.HHSH9uIAuH|$dH3<%(LH([]A\A]A^A_fIHYAF<t<t< T|$IIt:H $L1L)LHl$wHsHA,,Hl$ALL蟻;DUSHH"HHHtHH[]醺fDAWAVAUATUSH(dH%(HD$1?HHD$hL,H|jlL9IHseHD$L=lHD$fDE=+~k Asg  HH9ЈLuHlHI9wEHt$dH34%(LH([]A\A]A^A_HHEHL$L1H)HLd$HsH mmLd$ TnkIƸfAg舼AUATIUSHHtEHLkImHxIE}HSBu BHBѸHHuHL[]A\A]Ðf.UHAWAVAUATISAԉHdH%(HE1蓻HHH)H+IHtAts fA MLt-fLkMeLLIE$HHuLLHMdH3 %(uvHe[A\A]A^A_]H@Ht8{L%~+Iu)J}+D$$cDLIH5!}+LHB$2AWAVIAUATUSH(dH%(HD$1HD$qHxIuiA/I@t@JLLʺK4'HL%hLt$Ht$O@tg@=+~}AH L f.*HH@kH9uIA/@uHt$dH34%(LH([]A\A]A^A_@+IHAoIG@tITf.HT$1LLHl$L)薹HsHA/;;fDHl$A/"f.AfAE9fDA LL肶HATIUStTHsHSHHH*t4HCH8HSHH:?uрuˁbf.L[]A\HSHtbH[f.AWAVAUATIUSH8dH%(HD$(1HD$ |HLE11ַIHD$ L-fHD$G<D}t<=q+D}~'I4ALD|D9gEDHcL9s$A<uAD$IcHcAL9AuIcAH|$(dH3<%(LH8[]A\A]A^A_IcHHH)LfA  HA9Ah@LT$ HL$LH)1LD$LT$HLD$LT$sH"LT$ ѶAWAVAUATUSHHdH%(HD$81HT$%IHHb> D$Hy+H E1u"6fDD DDHt tuAHut$H辵HAH$HD$,H$x+D$,E1HD$tuHT$H4$EHL9HItV<L$uHcD$,AHv < @LHcD$,I4HD6EuKMI}t L1IH\$8dH3%(LHH[]A\A]A^A_=+HL$0HD$0 DLkcE E׉|$,AFHcA 7<AA A „MA<v DMEDE15р<t7AL7~1A< HEuA8tɄEu{HcD$,A P@A~=LLLHJHHIŋA%ƃD$EƉA^EDME}6D8mA<b YGD$,HA A<v <GIH(fDQv H<LƄuӉD$,fH$1H)"HH|$,|$,@HD$aLfHL$IHHI"f.|$,OE1:<AH$fAH$SLL$L$H$9Hru+E1D$HPv< u@MH=&t+fDt.<IABPv< u@8t~  ~ 1ۀ~É\$fDD$,x|$,H$kE1+zD$,o>t$,|$,t$,OHt3SHHCH8HCH`Hu[fD*HSt5@tui[H5HIfu<[HCu[tHHHcHH5[[1HUDH[H5gHHHH H[@HcH=&+?t -+D+t> +~*H +HL HH9t 8tu +fD +t  +uHt1fDHHtHcE^Hcr +H5w +HH[f.1f.B +fH9 +SHc߀<u[D軸H +- +[Df. +tF +~ +<u8HI9u9}9- +H[]A\A] + +u@f.AWAVAUATUSHdH%(H$1HH|$t$ HD$H5Sn*D u u8HD$H=8n*HD u t܋"*H= +(H= +0*D$$H|$Xf.+b*+*D$(u b**4D5-+-a*1ndAĉ-a*u9L: +N +0 + -+ӓNBEuis*:H=*|$\K+H5L1萫H=-H1OųD:*H51QH1D$(|$X`*L|$\C1H$dH3%(H[]A\A]A^A_Ë-+1H|$XD$$ҬlH5#1ǪH=,H1jD%!*EI,+}@蓒|$\蒴D$XD$H+n+H11u&Dt1Ҁ 1Ҁ HuDL$D$4AEHD$`1E11Dd$DHD$8D$ A܉l$@LD$HED$D$3L9f|$3A HcAHD$4 D0LHHDLhEEt[AD$A9&D)HD\$,F8IcXD\$,HË|$IcAt$H؅lHcAHDDD$EwH51H=+H1D$FfLt$8|$L@HHL#fDD$@u AcA mADLE1sD$XD$|$jDD%h^*se\$(=)+D%Q^*]* *t'=*t*u)+u 1#_ \$4L8XIDDd$DMHcÅAJD$  Hc~MA| uESHcA|HH)HA| uHA|H9ЉuAD$XD$='+^ªDH=j+H?z:D$XD$DfD=+EO+sL뜃11N\$\H=m*(9t1\$\H=I*9t\$\H=*9t |$\K\$XH=(*9t1\$XH=*ϩ9t\$XH=P*軩9t |$X+v '+8=A+u+e*a<=p+t賩p+H|$H=xo+1 *藮uh'+T$$H|$H5|V*Ʒ-G*D&+D+EujD$LD$LD$H1|$Ht.|$Ht'D\$HEu{%+&+H=%+1D$HҭAWAVAUATUSHXdH%(HD$H1HHt$HT$ I̓D'D$HD$Ht8uD$E@E1xSH$HD$ Ht 8A@1ۃE1D$LMIHD$@HD$LMIEfDHM|$L|$@D$HT$8L9 LcA?LLD$T$HL$8Ht$LɒQHL$8KD%L)HL9xI@L9sH<$LHL$(RHL$(H$HMH$HLHL$(J<(輠HL$(MHc+H$Ht$ LDH<(Hc莠|$L|$@fDMH$(Ht$HdH34%(H$HX[]A\A]A^A_ËT$Ht$HL$8LD$@Lő(H|$ HD$ 8 xmHD$ xpQH$YA?WAtAHL9rfI@L9sH<$L{QH$H$LH<(跟 fHD$ H8xxH1軡EHtAH|PHH$<|$H$LH2Ht$ H<+$xxAxAH0I&PH$#f.E.AAl1LנH,MLcM9sH4$Lr.HD$@vI@M9sH<$LHT$OHT$H$~OH$H$wdOH$H<$LXL7HEH{1%OH$OH$Ht$ H<$谝L4$Ht$ L蚝I<L莝NH$fH|$ 襟HxHNHH$"A{NH$AuH{]NH$Df.HH=*H*HAWAVE1AUATIUSL%M1Hht$ HD$HdH%(HD$X1ўHxHD$0MHD$(HHD$P1HD$ HD$HHD$8DMtAtv<'<\<"=4i+A 9D$HLHHL$y\$HL$HHcMtAuHt$XdH34%(EHD$(CHh[]A\A]A^A_ÐD)HcA:f.HcMtAuEE\HD$ D taE'HcHEHHcfDL$ D H5^*@E\HAHD$ E1HHvLcK|5IAIcIt tA't<=g+A<siAIcIt uHt$DLDKLD$IA8HHHE1ELHZHcfLLD$P1H)HL$ LD$贜HLD$sHgA'LD$PAfHD$0LD$H1HL$8LH)LD$H\HHLD$sHD$@LD$HufDE1HcAWAVAUATIUSHHdH%(HD$81t$$HT$(HD$0hE1Hv LgIHD$0L=J11IPI!HD$HcI4<tz`>wMIL Ȁ~Jހ:wLHE=e+A sKHcI4<ut D$$L虚HxILHEHDL\$0HL$LH)1LT$L\$跚HLT$L\$sH{fDL\$0t$$LHD$(HHtfH舁HIw@(_@DLL "EHbAD$(Dt*A9D$,1HIMHnH^HfD1fIL-9+u AM|-tA\$A?L1Hx#FLHȔIAD$DDD@uXEAD*DLH+HIu@(H*DAA@+@Ht$LT$D$ϬT$IljMDLHHI臺M61WA/*!H}HI@('@DLLEHAD$(HHDLHL$%HL$HH1@ApHgL1wIH1螹yDHLk%H2H %1DLEHHHL$/HL$IM4HH-AD$(@LHL$HL$I1DLEHHIHHL$HL$I{LHL$HL$IaSH1 H葸lff.H(H<$HD$dH%(HD$1HT$dH3%(uH(ffDH(1H<$HD$dH%(HD$1HT$dH3%(uH(茓ff.HSH=V+HWHV+HHD1HV+:H5}U+V+ 1HHf.t Hu躒H=SV+HKH裒Hw]HBV+H+V+[T+H%V+T+fDHV+1HU+UfH=U+H聏HcHBHU+Hw[H5U+H=~T+@HU+Ht+WHtu H?T@H?H5QA1f.ATE1HUStcHH5:U+HHIHmHtAH}H5U+MtHf.HtHHHmHIHuL[]A\fHtS?tNUSHlHHt+H[HH HtHH[]MDH1[]1DAWAVAUATIUSHHdH%(H$1T$8L$LD$LL$HcD$tD$pINjD$p+D$tHA@D$p+D$tHADD$pHcT$tD$pDH9HcHt$xg #0HH1HH߉D$pHHAHpL=IHcD$tAHcD$t<!IHˋHHcT$p HP:T$t4HcH N*4  $,@D$<D$0D$tD$($DHc 3#U|3#@x9#D$t߀^t ,Z.l$dD$<D$0D$($,fDHl$pHHH蜔I@@D$ L2H^H.*I9 H*I9 L膉H-*af.1@}D$<D$0D$(A<#A$ IA0< L:AD$@A<#AGHcT$t|}SH M*DtAt)0Io< w Hгu1H*L_HHH9D *E3 LH-*]D$tA$7AOHDHHu _D-L*AtAWD$@DE*Eu#C?:@D$@Aŀ*A EfH541荊H5~H1,2<!D-þ*Eu#?*@VL$T$8LD$xDLE1 kHHD$HN1LtD$8HL$LHT$ƃD$Dr[L\H;P@t *)E1x]A< @> HHt$xfA< vaDƽ*Eu#4?+@"*fAWAD$@E1AD$@E1|$@D$ SHcD$tMw|} DLw?Eu"1LwHt@)y fT$81LDmHL$HT$IƋt$8H&qM At0< : A~1LwAt0<  A~O D$@T$8t$@E11LriLHD$@HT$@Hy*H9XHy*H9HH BD$ %D$ BA0IIME1$t9Mt1A1Et!|$HtD$8tuA~D$D$}Mݸ;w!HHHЃ<%T$8Ht$tHDD$`螁HcT$tHD$@DD$`<}H2Hm+(H5C1蜆HH1?H|$@Ht萃M2L%D$@A@<@^AD$ D$8tHD$HtHD$D$ HzDH IG*D,A,'<#sAD$ ?f.T*"@]1LL超Hx4LHbH$1HHD$HkHtH^H$@t*u x]H|$H5VDIHAG+fDD$<D$0D$($*@U݃o0HH=KOHtHcD$t<}#AfT$H7AwHDpu@_T$HL葄Hx3LH=HHrHDu11HIIIHcD$t|*S t$81LeD$8HtHD$HtHD$D$ HtLۀLHˀD$tLA$軀HHD$ E@D$@ADD$tHD$@A$D$( D$0 D$<E݃}L$(& Dd$0EDD$ HcT$xAAMHLLH$L=+PL$HL$i[]$1ۉD$HD$@8/Iu L`LׂHx1LH胀IʼnH  D$8LE ؃@D$E1A<$/@1HIT:/` t$8LLcE1H$H$H<#z<%|$/D$?upH$HD$Ht$H$LDT$HEuH$Ht~H H HD$PH~H<$t H<$~MtLs~Lk~Lc~H|$@Y~MtLL~H\$PH*H9H*H92HHHHD$Ht DEHD$P8xD$8MfDMD\$(E9DD$0ET$<b-^ ?O @ @o }L_}jHŋD$ LuE.H51LH1L}#HH*BHH*H9gH*H9Rf.LH-f*|@HcD$t<}L,/@h@IHcD$tP,T$tA<#A4,AH@*4 HpH>zHt$ Ht$ HD$@HHx%.Ht$ H|HT$@HB@AH@* D$@E1MD$HD$t@L訦iQD$ HcT$xAH*HLLL=*HD$H$PL$HL$?dÃXZ/H$Hl$@H$1AAHD$ H$HHD$:f$hLcL̀}:1H|$@[HH$HHT$HHD$(GHT$IHz$pA AF AH$EH*uH$Ht2z1H*LH$zH|$@H$tH|$@H$zH$MtLH$yH$H9H`*H9KܹHHHHD$Ht D(E;{v/XD$<D$0D$($LA@+fD0INjD$pHcT$tD$pfL8t$@5V*tA<@<*yER DL$(E|$0_D$<LxH|$@HD$X H|$@xMH\$XH*H9NH*H9iHHH1HD$Ht DEHD$X8 2<3!#@@H$H*EuH$Ht wfDH`*HLȱHDD$ HcT$xAA%t+k#HD$@H8tMt A>H|$@fw|$ D$  +H|$@Ht$@D$ D&AHD$xD߀At MHHcLH$LL=V*PL$HL$\AY^FAD$< HHAĉ$D$zH$H$<$\EHuH$HtsHD$8HzHH$rL$LrH|$@rLrHH*I9H7*I9H 賲MHL({A}pA}`fHHD$@H 8^HA@HhAt$8HQLIA<$t$8LgQHHH5[H̩HILqH|$@qLqHM* H5#1H-**utHH1ZEutHS HD$ H 8 xMmI9AyHAHEHT$0HHD$tHx!#Ht$HqHHD$ QHL$ HD$HpHt$(H|$E:]H|$Hp$AEHT$0AHw HH I9 H9H4$HH5*AAAH$#sH$HDd$ T$< L$HDŽ$L$rL$M H A AxH$t(AxH$t1HLHHHH$H$E1LS!Dl$<1EHD$(Lt$0DMfHcI4A9==+~XA<s̓H$HL$(1LT$L$H)HlrHLT$H H$Hd*II9_MQDHD$@(@HD$hHcP jHA{H$HH*H$DD$8L@(@HxVH*HD9DeHHu E H~Hu DD9~ H6AHuHD9I  II,$AHD9uI$A?T$8H $ L9HH $tI,$HtD$8H*9HH$#H轮HHH?mH$ EL$HD$LH?@(@YH@P HD$hHcH@H*1H:AH u H *Hu DH PHuPMHcOHbH$1H$DH@(@Hx@NHD$X0H$1腫HHD$ ILt$\$ &fI}L3I]MmMIEDHH8Q^IMHuIH$HD$H$LHt$@(@HxHD$PL"*HD$@HtHckL[kH$HD$蘪HHD$9Hl$Ll$0IL|$ Lt$(IELHH8LIMII}M>MuMmMuHt$%L|$ Lt$(Ll$0*,H|$HHD$PH Hl$PHHHpjH\$PIY\$ Ll$Lt$؉L%*衼LIHD$XM Ld$XLbLHiH\$XMtLi=u E?+CD$8tH\$HtH\$HttL$8H\$@LL$LD$L$8LE1H蹢HHMiLEiH#HD$@H;8,HAHhA]HD$PcH$1Hm*H*HD$P;D\$E(HD$ HcPH$HHD$|$B D$|$D$*HD$II*ƾLt$0Dl$dL6dAHH H=*H $E1?H $HH谦HH\$8tHD$HtHD$HtLcH|$@tYtL$8H\$@LL$LLD$L$8+HHHc0|$H|$@ccLE1XcLKcH|$@MHD$PH5Y1*eLH1螰LbH|$@bAA|$CHD$XE1H$H5G1eHt$H1"T$HL$ LD$uHH=3p:IH$DŽ$D$|L(M ND$A`~A~A\jD$ ELcʼnD$x A$vA'uD$DLcŃLcI9G<C4D$xD$xHcE|T@A<FA=jH4$vq@ 9D$h H$rHI9sLHLD$(LD$(ITf.{H=*HD$ HtHD$HtH=*HIA| <PD\$LcʉT$xKt An |$Lcy } D$ L *DC#HD$HtH$@ D$x$LLD$(PLD$(IMTLH‹)к@HD$HGlD$(H/dev/fd/I@H8HcD$(H$ HHD$X&I~HJ;Lӛ*D *MtD9L$(|DL$lLD$`F=LD$`DL$l< *L$(9| Ap*LHcDL$`Hc|$`U*1HX*HD$`)HHcV>LD$`HD$X-*Az*D)҉D$`t =*u E)W*T$l)1T$l T$lD$XD$D$XT$l* H=*tj1Ḧ*D$`)$|$HFH|$P 9DHDŽ$D$x$H$HD$0;HcL$xHIsI| HL$(;HL$(HHD$(&@H=w<s,AIcIt tb't]=F+AfDHT$(1L$H)HL$0;HsHtL$Af.It$xDL~A?HA$Dt$xH7H$D$0@Pl$xLcA@H=w "AIIVLHcD$xHHL$xADBH9uCLcAH5L謃I@=+A(H=LD$(LD$(IAIVLHcD$xHHL$xADBH9uHcЉD$xE| LfDAAHD$(McC|U D$0HHL$(e{HL$(HI9sLHވL$PLD$HLL$(vL$PILD$HLL$(H|$(uH|$(H $IH8At %A FAtH$AN@tH$AN@tANH$E11ҾLDŽ$IH*$L$I9H͖*I9LMcLkIG$Ht@ t DŽ$t%H|$ D$|HtHL$HtI?D$|"1ҾL{IL聰d <LD$(LD$(IAIVLHcD$xHHL$xADBH9u]hsHzHIxHΕ*D$0D$8LHtD$HD$@H$H1L$H)H7Hs%HHxHD$(HL$(IL$HT$@H$1L$H)6HxHv*HHD$(WHT$(IHzIL$~A|$4H(HT$@H$1LD$(L$H)G6HxLD$(Hv8HLD$(HD$HHT$HILD$(HzI@L$iLL=)*d2L\2ILL=*H2L@2-DT$xMAQHT$@H$1LD$(L$L)5HxLD$(Hv;HLD$(HD$H HT$HILD$(HzIL$HT$@H$1LD$(L$L)5HxLD$(Hv8HLD$(HD$HHT$HI\LD$(HzI @L$HT$@H$1LD$(L$L)4HxLD$(Hv8HLD$(HD$HHT$HILD$(HzI@L$LHcA||D$x$(HcT$xD$|HE| LQwH5HRhILp/HT$@H$LL$(L$H)13HxHLL$(Hv/HLL$(4HuILL$(IDL$D:A~BHHHD$Hm5HT$(HL$H HHL$(/HL$(H/LcL0L2HxLHJ0IWHD$HILBD$(OD$(HL$HA>u A~LHL$(zHL$(L /L/ILN*L4$Av贤Sђ*H $t=Ò*&}H $*t H $?xH $H $t* *$H $t x5H $H $KD5~*H1sA>H $tH="e*H $iH $1ۋ|$HA>H $13D$H9t;H=z*HtEHz*|$(:HJ*H\$XH\$P*H sH5Hߺz*C-z*:* O8E1jD$Eu |$0MALfE$mH1HHoD$IKH -D$0\H51E1/H=H1B0H5à1/H $Hlj1H|7D$xeH5Z1/H=H1ELE1z,|$(y9|$Hp9OD$0fDUSH(dH%(HD$1H?HT$:/HxAHH,E111҉HH$<*gHH*#*H9t^H*H9tRH<$Ht+Ht_HCHtH8vHC`HuHL$dH3 %(Hu,H([]ÐHk1HnHf1.SE1HH*H9tHь*H9t[H*_H*H=U*K*Gu@11҉Gt**HDH=* *Gu@11҉G4H*tHHtf1HfUSH(dH%(HD$1H?H*D$-Hx#HH*H11҉H$H<$HHt)H8*tFHCHtH8tHC`HtHT$dH3%(HuH([]1,USHHt=?t8 HHt+H5H$aHH)HH[]1HH[]ff.ATUSH0dH%(HD$(1GuhH *1H<tHH u Hv*Ht@HHuHHt$(dH34%(CH0[]A\fD<@HtA<*t=H )Dt|uv!<+HHcH{uJH *1ҐH<tHH u HQu*H[HHuCHk1Hu~Ht$ HSH|$ gHH*He1;t{tH(f.HHD$c'HD$fHT$Ht$ HHH@(Duxv*$1tHkHt$ *€@ ʨ@9HcD$DH|$ Hz?1yHH>H5H^HI蓢HcD$HT$ MD]A<$/H|$ |L^&Hf5u*R1)tHc=)HŐHt1}t#}t}t H)DHHD$%HD$>fHxHtkP(ucDt^@HxYH5HH(H;7{H&DHp(HxwHH&$HH HHH5H\HI%HM'HA<$tA|$t L&fLHD$$HD$f s*4'1H~$1H X*1H<tHH u Hq*Htf.HHuHcHHc=ƨ*H̜HHc=ɨ*ȽHHD$ HHPHT$ X@u*hzHD$ HDt ~]T$HFC(HHHHD$ ~&HH|$ H?t$1;{{H&A<$.A|$A|$ L%H"uHCHD$ .H?1HHHHH1ٛHH{LeLHD$ ("~]8HCHHc@ h;{P{A1HHHHH't@1HHcEHSHRHDHH|$ wH1H{HcD$HT$ D]HHcD$@]$HcD$D]USH8dH%(HD$(1Htu?HtmD$$Hx%HH!H|$11҉HD$H|$HtHD$ HD$HT$(dH3%(uH8[]D1#HStR?tM*FHH*t,H@HtH8SkHC`HjH[1H[ÐUSHHt=?t8HHt+H5HWHHHH[]1HH[]ff.ATUSHH8O@11҉1!*\HH *tztVH@@q,H5܎HMWIH[LHEH=H[]A\DHiH5H WH@1H[]A\fDAWAVAUATIUSHHdH%(HD$814$HD$0!E1Hv L!IHD$0L511IPI!HD$HcI4<tz`AÀ>wLHA À~EJހ:wLHE=*A s[HcI4<uXL!HxLHH\$8dH3%(KHH[]A\A]A^A_ÐL\$0HL$LH)1LT$L\$!HLT$L\$sHkfDL\$0LD$(x HxLH$4$H|$ 11HD$ HHtfH~HHHtNHvgH5vHTHH$H|$ H$HH$H$H|$ 1Hu$u $4$L蚀H(dH%(HD$1HtO?tJH<$HH}*D$@}*HL$dH3 %(uH(D1oDf.US1H?t@E1`HH5MHSHH×HtH߾WHHHHH[]fAVAUAATUASAHLH@dH%(HD$81Mt HIHt$(HFEHMHxTD$0HD$ H$HD$ HxHt$0AVjH|$0E1E11DH|$0HD$XZHD$HHT$8dH3%(H@[]A\A]A^D1H覬AHL$LD$0H1DHËD$.H;Ht A[HHAtuHD$0HEjDH|$(VZHHD$ tL8Ht Aje[HH|$ E1Ht*#fDH5ϧHH E11YHD `f.Ht$ 1HqHT$  @t *z]HHL$@(DDLD$0H߃HflH^;Z{PAEDE;fDHHtsHxH@(AA@?t AZH ^H]H81HF HHXH;1HM;lHCAYH5j1*HH1eHoy*(1lH O]H "fAUATAUSHHu*t%1~ Ht@)tLhMt A}ukE1HDE1HHHtAHu,ZIHDHHL[]A\A]fD_IfDL0Hx7HLH[]A\A]fAWAVIAUATE1USILH8dH%(HD$(1H4$L$ DD$Hl$pt L1 VIL1L]VMII|$MM$$GN1ҩt D$0-@@@rD0AL LD$@1LM9HsMQI8-cfDx-fI:HGtBDHw(IIAAt@D@uD$0-I:fHHuM M9t MQI8-tL$@1 fDA Ht D0HHH=u@D0~mIGH8RH8I1>IHH€:=1LnRH|$0IQLHVRIH L$萋$IxNIG1H8A>IWHHIHHD8+uIg=pxL$@wLIM HrD0gD0Au.D0gIHD8+D)EyH:E11H+HH$HrHHSH$Bu%=tH:{HtHCH8L(IMYLxALHL$HL$uKLD$A@AHIHPMoHMMLCL(HI0LD$A8EtHLNH뱍rD0aIGHH{Ls*HrD0gBD0ao1IGHH)L!*mHH-[n*HtHH=n*HHHHPBIHHHuHn*H'n*HHH>* HmHH}H*uH *uϋ-C**<C*.D$?Hm*H/H4L5{Ԑ*E11E1I9D$L-*D$H*DH{*Aօ*L-^*uH5{I9_m*HHuH=l*葇Hl*H$dH3%(HH[]A\A]A^A_HRM I}tL1OHID$ tD Z*EoL}UHŋt$xHOl*HHeHHE*HH8SHD%B*EH=k*D|$HHH 3IH9D%Y*EtVHHtNH5k*HE1 HtIHH HHHHHtLBA@uHHHuEHk*HHAHP1hMtLHLeMH1NHL L#I911:RIIEH8 IUL"ImE1LL#L,$MIEH$IE@ H8uCIEH8tLLHIt^H5*I9tRI<$Ht]Mt$E1IILHKI~IHuHt_HH1NI]HL[IHIEH86QIIEH8IUL:I<$HtD4*E=5*ImLfHi*H ?**?*AH}HG+HEHH8E1HA3D%*?*EE1L5C0HtH豃HhH}H1SLHH5h*gI]L*QIEH5gy1*H4 H1HTD$HD|$E1zH=fh*HEH8H=D$0E DffDVfDFfDSHH?H[f.H=`h*t@H@HCh*HfDH=1h*HtH5@f.)tfH5g*1HtXUS1HkHøHt-HkHtH}HH{H1H[]f.@f.)AVAUIATUASHH5bg*AH1LHH@Ht`H8`HxHxLuHH HUI1EB;/tJDe[]A\A]A^fDfDL Hx'LHHEHEuD@VHHf*9)ATUSH5of*H1HHH@L @IEH{;.u {/HxsHŸ./HH}fE HctH[]A\HA<$.u2/LHHtH=m11L4/u'LHx[LH]A\1H[]A\fDHx迵HHdHQf.fUSH莵HuGxHEHE1f.HH9HH[]fDHcH4HE]E HH[]1HtG @AWAVAUATUSH8HaIH;HD$ AEHD$D$ fIEHT$L4HD$ HMHT$E1t{IIMfLYHx`LHIvIGHtHHHAFIwAGAFIM6AGMtM uHI1HD$D$ HD$H(D$ A9E'AE HL$ A HD$ H8[]A\A]A^A_Ht$(Hx蝳Ht$(H@HQHD$ f.1t'Hiȓ1Ȅu@f.1tiH1uV!@AWAVAUATUSHH T$ D'EHA1fDiH1uFIIDpHA!HtEIcHHu7HHt(9kuH{D8'uLuރCLD$ th Mc;HIEJHHHHCL{kCAE HH[]A\A]A^A_f.V  D1@1$HAWAVAUATUSHDv ED/EHA1fDiH1uFH!HLtHH=s],Ht1HmDHD$dH3%(u H[]A\Zf.H=X*t@f.AWAVH=mAUATUSHdH%(H$1HIHHx賨LHXZX*Iƅ"Ll$11fDHAX*HL A<$LLLx`H|$@L;|$hHW*HLxML<$5H=@l1L HW*LHHH H8HL$uHL$H;L$@aJHW*HHHH9H}4H<$gHIHLk5*uaH9-f.A*u%U*%U*A*u%U*H[]A\A]A^A_HL*H={*H5tT*H M*HHq*H^*HK*H8*H1U*/U*T*H*fAHGHAHH=u1=HH6*=H=)*S* 1S*=HH*=H=t*S*1pS*c=HHL*O=H=?*MS*t^BS*(*u Hӗ1=HH`*=H=S*1S*t'&S*H鑗띃\ATUH R*SHcHdH%(H$1u*|$ Ht$D$Hg*Ãt1Ã@uRH5c*H4HHt$H5H9t t7H$dH3 %(<H[]A\1@HHxHHHD$8\$ C*S*D$LS*@2H$ HD$0HP*AHP*HD$ H<*H<*HD$(s*D$D0D$Hr*|$ At HD$ H$ H-)Q*HZP*H|$01Lcd$ HD$(*H0<*BDƒ BTT$LR*D$DD$DH|$PH5[r*@r*&s*%:D$HYH=2r*r*D$Du8D$ A҃Ht$H|$8r*fDHt$PH=q*9H=q*1D$HfDH|$Bd&fDHٶ*HcH*QtSA`*H5RC*`*[ÅtV*~H=*H$H5QATL%g*UH-_=*S1@I<t1dHHAuDtHHDu[]A\1gdIH=It@H=d@H<*HcSÃt#@u'tB~0At[BuN=*QtX[@1ۉ[f.u$DH5PD빐+fH5 QBf.H)<*HcDf.H)*HcfH;*HcDf.H;*Hc@Df.H;*HcDf.H;*Hc Hk*HfHY*HcHf.HY;*Hcf.DHc[*HZ<*Ht)HP(HtHHHrHp(@|@ff.S<*=<*HcH4H=;*9 ;*H;*9}(Hc)HHHD@HHH9u[@f.b<*ATUSHc[*H;*HHCHS(HtH9tHCHJHK([]A\D<*C ;tuHSHssHH~0HCHkHC([]A\=;*%&bHCHHCK []A\f.1HSHsIċ;rHH~;1|L)H9`;1LdK Hs;HC8rH+=;*u%C ;os8H=PH1%USHH:*iHc9*9*9t0H-9*:*:*hHH9* th5:*u :*t:*S9*M9*v=9*V$9*ksafDHpy(HYH5O1H1H(8*8*H[]ÍP8*H8*H[]D=B9*#1k8*t%t!Hg8*U8*Hc@<f.=W*ta *u=G)1@=W*1=iW*t1 *1u 19=)fD9=RW*ufAUATUSAHHdH%(H$11DWHx H|$0 HNl$0HHDH%0ID;%!7*H}dH7*IcHHD#LkHkC HC(HCuC H$dH3 %(Hu-HĨ[]A\A]D1@D1fH11CxH@1HfHt;USHHHc/HHtHH:6*HH[]@f.AWAV1AUATUSH9HcM9=5*E1=XU*H5*LcN$N< HI?H(Ht*HtHUHt H;WHD$+HD$H(H0`0HHHD$L%\5*HD$II$HtSEtH H[]A\A]A^A_E19T*AM1gfDHtSC[c1DSx;9=4*~$H4*HtHcHHt H[!f [@f.H14*HcHHH2Ðf.H4*HtEHcSHHt>HsH+s(uHC(HC1[f;H޺Ҹø[fH3*HcATUSHՉH<t93*>=R*~n*9-)u)1[]A\fHA3*LcJ<tH5hJ1H1H3*J<=yR*߉{R*6Opf.11 p/11UTH5I1:H1!0f=Q*t*u ;=)t1D;=Q*uH'u1HfVHfDUSHH0HH=6t$HIH[]H5a@H=Y@SHH>2*~>H'2**2*HHH!2*HXHpH2*HH[f Ht$1Ht$f.HH?HcVH =f.H=1*HttHH1*1*91*}dHHGHW H@H@@@@@H9@uHcT1*PK1*H81*H<fDCAUATIUSH-9IHfH 1*HHSHHH0*H9H{\1ҋ0*90*}zHCHS L+@H@@@@@H9@uHc0*P0*Hp0*HHu0*HlMH[]A\A]HX3M_H{A$8NL>0*90*HHCHS H @H@@@@@H9@uHc/*P/*H/*HDHLH=ZF[]A\A]15DHcSHsHH[]A\A]l~ff.H}H//*H /*HÐf.S-/*H1/*/*[f.AVAUATUSH.*HD-.*H.*If.H{L3L5.*.*9.*}}HCHS L#@H@@@@@H9@uHcO.*PF.*H3.*HLHuH= EH1D-3.*[]A\A]A^fDH}H.*H{E8MH=-*9-*}]HHCHS H @H@@@@@H9@uHc-*Py-*Hf-*HGHu|:H=X-*t&Sc-*Y-*N-*[@f.S--*#-*-*[fH=,*t&S-*,* ,*[@f.H=,*t&S,*1,*n,*[fD@f.H=x,*t>S,*tu,*H=S,*u_,*H@,*[fDfD1H=&,*fUSHH,*Ht>HfHHt(H{uH{E8uHuٸf1H[]AUATIU~SHHcD-+*+*yHH+*HcH{LckLHHHCH`+*D-m+*H[]A\A]f.@?.t{=@+*^2*ATUS!uFH)IH;Hu:f.HH;Ht$Lt[1]A\fD[]A\fDGt<.uk1AVAUATUHSH?fDHH|u誋H}IHHE1fHHAIH;MtHt)IcHMtuH;H$H;HuEIt&IU1HtDHTHITHuHHEL[]A\A]A^fGfDAWAVL5wAUATE1USHHdH%(HD$1H$IL,HK2?t$~K[\tC]uLEHt$dH34%(H[]A\A]A^A_Ð!tUIu{HK=ߒ*Hi~AAsTH]UY*t+uS(pH3SAH"@tfL1LH)HH$HsCHHlHHDH]USH@1fH$UH]zf.H1=gDt$ EY9] A= McMcD$ B (B4A: McMc1B (B4D?Lc@>HcJ<L<0fA[ McMcB (B4qf.A[ McMcD]B (B4@]DD$ 0fAL$H|$DMnf{2JMcۃB]D$Hc4 f.Dt$E9]A. McMcD$B (B4~QHcL<JMcۃB]D$ Hc4 GIxMpAWAVAAUATL-kpUSHI@H8dH%(HD$(1HD$ zH|H|$H|vpIHHD$ HD$UJ߀*9*$**tu`u)u2ttnfD^fD)u@H=)~***uHH*uBHD f)ttu)us*u#HH5HH*HDf.H )th*H=|*8H|*11H=|*G()uH%iDH5u+t7H5PH*HhfDKRfDH5)f.H5*f.DAWAVIAUATIUSHHLt$dH%(H$81LTL$LHl$hLT1҅x1H$H$LLLLt un1tf1H$8dH3 %(HH[]A\A]A^A_DtL$LD$ LTT$ gt9~/듐19|H;,$… ЃsH $H9!ЃH9 ЃKT@H1|H=>** f.AUATIUSHH(dH%(HD$1tALl$L<"L$HD$uo1H|$dH3<%(H([]A\A]fDHt$Ht$LHD$Ht$wrH )HcHfLL!T$HD$utH9efH9UfH9EfH95fH9%fH9HLf.H5)1HI1H_Df.O1G3wH HHDSȃIIW=ރ@u1[f.!wtw@te 1@euЀlnjgu[LL@ulAA8uLL[fD=u@uHA A8PLL豰[=w<@t@t@1[òDlnt|ou[LL>fD@f@qu[1LLf.V* H) EЅtLL[fD[1LLf.[LL?g[LLfD[LLw[LL[LL * EЋn)tLL[@f.SHdH%(H$1GG<3wBH%HHcH@Ht$HNuD$,9Z)1H$dH3 %(QHİ[fD1>fDHOffH(HP(сс@@YHxNfD@fDHt$HM#D$)uHt$HMH|$@fDfDHt$HH|$HcH9Ht$HMD$(%=o"fHx<Tf.1>=Ht$HL#D$)Ht$HLD$)Ht$HcL1D$(pfHt$H3LD$(%=@BfHt$HLsD$(%= _fHt$HKCD$(%=`/fHt$HKfDHt$HKD$(%=fHXHP(HxZf.Ht$HKHD$hH9D$X+nfD>_HT$xHD$(%=1Ht$HJD$09V)1H6E1111HCFHHx1:HHxH52JH٧fSHL*dH%(HD$1Hc*I;-t$1HL$dH3 %(H[{uHHL t{tF>*<*t9}x5-*KtD9}DK|Hs*H*H߃*HHtBKDH5,5Ҧf.=tHЃ<{u8Ht,JTJtH11*[Ct<=t*H5s1豤HHfD{=uր{ufD*H=*1ҋ5*SAEZA9NHcHDA!{ujFA9\DH)LD"Dzu"PHI9&D)ˉHljƀ:!t؅ɺt5E*T[ÄVA9~4H|pA-u{uHt[61E5*[ÄA(uS{uA95*~Z,Hc5*H *HHH;)u{{uu*[[VA9LYt5c*H51HH:*Չ2*͉5**5*CH5H5|1蝢1HSË*;*}H *HcHр:-t[zauzu*1ۅ!fDSË~*;t*}H c*HcHр:-t[zouzuG* ff.?-t 1uDH|$H=*Ht$1赪t *HHD$H*HHt 8[D$**^tOuHD$H@!(t7 c*9 a*tYH511H΀xuHD$H@ 8)uxu***H=**ۦlHD$*H@8Pxl$HL$HcD$HHt 8]ugxua|$~?D${*q*x\*H=W*8*#H5fHHL LH=* Pjj 1腜H(À=*tH*HH*H=*SH5h1-H Ho*Hƿ10u [f.H5I1HH5f1ҞHH51跞HߜH51蜞[HÜFfDSHH胛H;{H[rfHH8HH0)u D@f.H=*t@H@貗H{*HfDH5i*Ht$H1)Ht H@H1HÐ1f.H=(*t&HHtH@H1HÐ1f.H=)ATUHSHtlgHItpHxfH~HxLHH*Al$ID$H߃Al$OD  []A\@薖H_)%LHI HxLHH趚HI$HxKHH薚AD$ID$HÜD tQ tLHH)襜HxKHHQHHǺL`H=V])[]A\ +DAD$묃Al$[]A\H5)HtKS1|HHt4Hx{H{HH=\)*HG)[@ f[ÃDH=))Ht )D$(H|$ NHL`LiH|$I\HAD9HD$HcLH<Et D$(tMcCD4< < U)1D$(fB)E1(1fLcANtDDD)HD$ HcMcLH|$薖DID)DF$9}Lt$Ht$IcHcLIcD$(AP@tDzMcNt-A6wfDBt@yT$@t$蓟t$HT$Dpl4@HD$0@LT$ E1MD@@\t(@8AMcNt-A6@@\uAMcNt-A>LT$ 1Mcf.AW2@9}H|$HcDHD$A>EfDHD$ 8rt$(~cAL$29}H|$HcLT$(T$LDLT$(HD$T$LfH=$HL$H D$(1mf.ADAN2@9}H|$HcHT$CHT$HD$D$(CH|$ HD$H8[]A\A]A^A_fNt-A>QAMcNt-A6=E@HtSGtLAUATIUSIHHHGHXH9ufH[H9]t LHAԅyH[]A\A]fDfDHt[HGHtRWtKATUHSHXH9t+H{H{IHt.LcH[H9]uH[]A\1f.Ht[HGHtRWtKATUHSHXH9t+H{?H{IHt辏LcH[H9]uH[]A\1f.Ht[HGHtRWtKATUHSHXH9t+H{H{IHtNLcH[H9]uH[]A\1f.Ht[HGHtRWtKATUHSHXH9t+H{oH{IHtގLcH[H9]uH[]A\1f.HtSHGHtJWtCUSHHHXH9t fH{wHCH[H9]uHH[]1DATUISH l@HHL tHIHxP@HHHHkHCHHC[]A\fDS @HHHx@1sH@H@HCH[fHATUStwHIċEA$HEID$EAD$HEHXH9t6HsH;IT$HJHAHHHBHPH[H9]uL[]A\fE1f.AUATIUSHHHIċEL9A$tY1HsH;IT$HJHAHHHBHPH[I9uHID$Al$H[L]A\A]@11f.ATUHSHOIHYtjH1 HSHBHPHCHXAD$AD$tbIL$H9HctDH3H[H9uHQL;%)HIT$t[]A\fG[]Hs)H`)A\D[ID$]A\f.HtGuHt~ &fD1ff.HtGuHtHf1f.HtSHHHtYH[P@f.Ht{USHHHGHxH9tDHoHCHH9uH9|)H@H@HCCt H[]@HM)H:)H[]@f.SHgH{.H[镊DHt f@f.H7DW+E"H9=)SLGHE1IxI9HufDD9tKHIAL9uIIIPH9uI@HIHIH@@H[LIIAIHLcLAfL) HIL9uHIA)DPH HHtHtfH_HHu1H[H)H)DuL@@1HH1Ff.1Ҿ@HAVAUIATUHSIHHI9l$|lL5E)IL$Mt M9"HYH9t%H;+}H9+tsH[H9uHM9 []A\A]A^DIT$L%)H)HJHAHHHBHP1AD$Il$[]A\A]A^HH{MtL*Hx1:LHֈILkL%`)1HO)[]A\A]A^fDHSL%=)H.)HBHPHCHX1AD$[]A\A]A^DH)H9+H9HH)H)Df.HtAOt:L)HWI9uMuoHBH9tH;0uH90tH@H9u1fDLPLHH9wMQLPMJOuI HOHHH9t H=1)H ")ÐH)H90~fI9tH= )L)I9uH)H)HGtxH9w|rH)HWH9uHueHBH9tH;0u 5DH90t+H@H9uH)H|)1fHi)H=j)H@D1DHI)H90~fHATUSt_GtXHGHXH9tKI1fDH{HHDH[I9\$HuHtH8t[]A\H1-D1H[]A\@f.HATUStGH1MIf.HCHLHHHHuL[]A\f.E1f.AUATUSHHtyGtrHGHXH9teIE1H;HHLHRHI藄H[I9]uMt I<$tHL1[]A\A]-DE1HL[]A\A]HATIUSt*H1HCHLHH"HHuL[]A\fHAVAUATUSG|IxIIIEHhH9tyAH]HtH߆Hx5HH苄HIcK\HmII9muIHL[]A\A]A^E1[L]A\A]A^fL͐f.AWAVAUATUSHXdH%(HD$H1HH|$t$,WH85I(HCLhL9HD$0H$HD$DHt$I}mIUIHHe`I}11P]HMAtA>tA~A H:AGtzAGtzAG9D}H$LHT$McMA[LA>IHT$tA~JD}McMAoAGHA]HLcA=L$K<HLD$ HT$藂HT$LD$ :tzAoHcH$IHD$H@I9EtH$A HcH$IHLD$^LD$HD$MmL9hvMHc9}LHcHT$3HT$IDHD$H@I9EH$AoA HcH$I@H8Au(HL̏HItDC(@t>I9HtL>rHL$XdH3 %(H0Hh[]A\A]A^A_1MtYHD$PMH,$HD$ID$HtH8Htt@t [tl@M$$MuLH,$jHLI9Y\f.Ht$LHD$L;HI1*=uHtID$E1H(HD$HHHl$(MtHtH|Ht$I#HD$HU=Eu7[.H֬EH5s6*<HE1=>*~wH "H4H fDHHSH9uHUaID$H8VpID$HL$H HxHH AeD\HUPHT$LD$P1HL$HH)LD$ osHLD$ sHU;;fLD$PU&fLd$0Lt$ IDl$E11IEJ HtH{WHCHHuIA;m|HL[]A\A]Ht fD@f.1I]fATUHSHIHZHtMH9hHtHZH{HtZ1MtL]Hx LH[HC1[]A\øf.ATUHSHIHYHtIH9hHtHPZ1MHktL]]Hxd LH [HCH[]A\D1@HSH1H_ZHt"HxHYH{YH[Y@[fDHt;HHH1HXHtH@Hf1Hf1f.Ht G t1ff.Ht G tO1ff.HttW tmAVAUE1ATUE1SGI~I@I$J0Ht)H{H{HHtXHkHHuAIE9l$[L]A\A]A^1@HttW tmAVAUE1ATUE1SGI~I@I$J0Ht)H{H{HHtnXHkHHuAIE9l$[L]A\A]A^1@Ht G t1ff.AWAVAUATUSHG tDH1DD$ AIHIt'HƸfDH9~+H6HHuLE1HL[]A\A]A^A_fIH1 fDHL9}8H+HIHuET$ uP@IH+LhfDAT$ I*ĩL9ItHL@*覩I뮐AWAVAUATUSH8HVDG EIHH|$ t$, (KHD$.HD$AAHD$HD$ Ht$HHH_11G1IH{H24H{>111IMt A?MMA>Bt,A~Bt"A~BtLT$(4YT$(D@DD9LHD$Ht$HcH0[LHVA?HtAAl$HcHT$HL$DeE]IcHHM=HLmVA>HtA~QDeIcHT$A L9{tLXULPUHIcAl$HD$H?H{2H{-(L{A<@<*H{Hy(A AE1LWPtf.ED9}H|$Ic+HD$ L9{De/LwT"fE1M WA?`A A aS"IAAl$HcHT$?Ht$HT$Hc݉HHt$Ht$ 9FA9"D)H|$At-HcBHT$HD$HD$)T$,tIH8!LH}SH\$HD$H8[]A\A]A^A_@AXL}!IDH{g!IA~uADeIcHT$L(VHcHT$= @BE1DLUAIcHT$[ E1HD$-fDHtG t 1=D1DHtG tf.1f.AWAVAUATUSHHKՋW Ht$I$GE11D$@I$N<0Mu6fD[HI@HHuMHuJM?MtRMoMtLuTHxLHlRHIHH&HLkQM?MuD$ID$A;D$SHtBH;tH1HHt*Ht$HHHHH[]A\A]A^A_ÿ1(HҿH1f.AWAVAUATUSH(dH%(HD$1HTDG EGH1IԉMPIDž~jE1D$ IN,0Mt8@I}LH菮I}Ht H$=PH$IEMmMũD$ ID$ A9GAG t`tr1腉HL1HHHOLBHL$dH3 %(HH([]A\A]A^A_@u{uH51LOHH|$HHt 8x|$~L fEc1|LtAG :L-L!yHH`RAWAVAUATUSH(dH%(HD$1HL$ HO =H1KPIƅ~ZE1E1fDIN<(Mt4@IH@IHt H$xNH$IGM?MuAIE9fL$ AF ˁ tetw1‡HL1HHHNLHL$dH3 %(HH([]A\A]A^A_fu{uH5H1LHH|$HHHt 8s|$~L fE^1wLtAF 5L(LYyHHPAWAV1AUATIUSL-HXdH<%(H|$H1}Ht$HT$ L$HD$@D$HD$Ѓ<<E1C|(9L$1)t$ {CD@<}@u <1E1>fD=*~RALsE1fDHT$HL$@1LLd$@L)DщL$dxD$dL$HL$d`L$dL@HD$xHt$,LHDŽ$D$xHHD$ T$x1LD$˅HH`HH$L|$0Lt$8HD$(fDH>= *HcL$xH=It H< É\$xD$HT$ Ht$,LBT$xLD$ HHHIHLLcE HAAqDL$~HuELcL$gAWJ4H<1DI H HH9uJLHD$=HD$HDD$xX\$xHHT$1H$H)HL$(@HsH\$x\$xDD$xH$X\$x^HHcD$ I\IH6@Hx=HH=T$`HED)HcDHELHeLIHHT$dJL$dGHD$(@t<.HD$(LHLL$pLL$8;LL$8IAMy<%1HD$8E1@HL$0DByED$D$fDH51ML|$0Lt$8p=HH1#Hk:LH1 t@1L;d$HDHD$8HLH9D$@HD$0D$D HD$(HD$s D$@D$\L;d${HL$8HmHH9JH\$8P1D$|$|$T$@IH$LLl$PH\$HL|$8Lt$XH5I1((Ht'\t/uS'"HHuH[]'Hqt:"St&{uBH[]9u1DLB@u\SLAHLƈ{tHH}AWAVIAUATE1USIH( ۉ)dH%(HD$1uL-)H)L1#'MIt 1LHH'Hx HH$HD$Hf)HtH|$ЅHS)HtH|$Ѕ)H&1LHd^HHD$&HT$IE)HT#A|,HcHctHIH$I<,IcL$H#Mt)u0L-)HL$dH3 %(LukH([]A\A]A^A_L-)H"H\$5fD5)H|$HH"H|$H"%fDAWAVAUATAUSHHu} HT$&HHT$t\}~bILAHAL9L"HA2HD<"8<'tB(H5)HHE1jHIL$|HcAuH@t-LI@\Luu}A$\UID$AT$} LE1R!H7Ha$LcHccHHH"EtBD-H!HH[]A\A]A^A_H=Y)M|$%HA$\II9EALIHAv@/LNfD5(u.}~ILAHAMf )uȾ!HHT$$HtHT$ffHIp@<~XLSu\AEBfLMI%fAb1HZIS@A1HZI@A\MAEI1E1SHdH%(HD$1H|$D$_D$D$螄Ht8Hu!1HT$dH3%(u5H[fHX"Hx_HH H̟u"DAVAUAATUSAHHH)dH%(H$1?)5)X)H!HxH IHEIH1S+H=E18o+HtR)HtHHb>HH5ELHE3HA?H6R)HtDЋv)Hcۉq)HN)-)))H)*H$dH3 %(DH[]A\A]A^H=))XH=K)B)VH~ HxHH*IfxnE1xA H Df.ATUIS Hu(H;HtE HH;Ht4S9}~)HcL8uc"u[]A\f.[]A\fDAWAVAUATIUSHH(HHGHD$AHH|uA|$w(HŅVHHEH{HeL|$E1AfIAHHtII?Ht@AIcHHtuҋL(I?HL$IcIAH{)H;{)I<H4HՃp-{)HL[]A\fDH5{)HH@H{HH)z)H5$HHz)z)<)E1;H)HL[]A\HxfH5HHrz)hD{(LH>:z)ZH2z)NDAWAVHAUATUSHHH9%)L=ބ)Hׄ)HHL5)L-z)D%_)-]G)H)H[)Y)3)-G)z)uHڻH)λH)L=X)L5I)L-)D%)-F)y)H[]A\A]A^A_ff.AVAUATUS5y)Ht ) Wy)x)HdH8.1HH<uHcL`HHH8HIH8x)Hx)M-DIuIx)H4HcHI}5x)Hcʃ9|ȃ Hlj5x)Hc xx)Hyx)Q@Lc-x)H-x)L%[x),Hcw)I4HHtXLHw)t}Mu[1]A\A]A^DLH$I9%x)L%w)u"Hc5w)H L/L%w)HH-fw)LcTw)fDHcI\HHxHH[]A\A]A^|@H=yw)<Hiw)[w)Mw)(H kf.HATL%)USH)H HY)H-)H)H@)HH9~)t( &L%o)H-X)H)[]A\@?ff.ATL%7)H UH-)SHЀ)H)H)蹭L%)H-)H)[]A\Df.?f*fATL%)HUH-)SHP)H)H~)9L%)H-k)H$)[]A\Df.?fATL%G)HUH-()SH)H))H)ɬL%)H-)H)[]A\Df.?fATL%)H UH-)SHp)H)H)YL%)H-)HD)[]A\Df.?fATHgUL%_)SH-G)H)HI)H.)L%2)H-)H~)[]A\Df.?f "s)AVL5~)AUL-~)ATUL%~)SH-~)H~)H~)HH~)H~)H HE~)HHg~)2r)L5u~)L-^~)L%~)H-@~)u,Hu~)[]A\A]A^@Ha~)HV~)uHQ~)[]A\A]A^ÿ?fDAVAUATUSHcHFs)t*Hcr)SHXH[]r)A\A]A^@HIx})tH6 H=r)H-s)H9t Ht HtH 1LFHHNjz) HxHH HHr)xIMcHcHIHH}r) C4*CD4I9tH LNH)H9tDH5r){Hx肽HH' IH r)Hr)@1Hq)[]q)A\A]A^1=M(Su y)H-?)H~(H=H?)ۚH?)[Ðf.ATUAS);)}AH x)Hc< t/< t+D< t< tE=y)p)T*=\t [1]A\鰮\D#É0[]A\fB55)H=4x)ډ)PHHwHGu }x)H *Y*r[]A\?fH=H耙H%DH=H`HuDH=H@HDH=H HDH=HHeDATUSHH7o)HH=7o)Ht t$ t$ Uo)I$Љo)<{2L Hx袺LHG H=n)Hn)Ht Hn)Hp n)Hn)HHcn)HHt[H. Hx5HËpn)tPbn)Hc Kn)HcH߃HAn)HHH2-n)HH[]A\Hcn)Hn)HH4HkH؉-m)H[]A\fDEm)Le<{^m)HcLdC{H2 HD }ff1NfAWAVH5 AUATUSH8dH%(H$(1HH$CLl$ I&I&f.H$L HT$ 1t #tLcH= Kt00BD H$ tIuHcD< Hcme<#]QHcADH< wIs9tAIt HA)ȹMcL(=l)l)BƄ$ W9|)p H=l)Ѓ))Ɖ5{l)Hsl)HH!%tDHWHD@HH)H_Hc l)H !l)HHL$rLHT$5k)HLD$HL$HT$LD$HHcJDD DIVHAT4IHqH<$ H$(dH3%(H8[]A\A]A^A_Ä< w ISHcADӄH< wIsK| uPHt>< t< t< v'HfDH< wIs"IHsH f.H=iHHt#HH={j)ti)HDH=\HuH@f.AWAVAUATUSHH-i)rHIAtHAHYi)Gi)@:i)h)A>i)LAHE111HD$1Hi)JIcAHTSH9ti)>ELt,Hbi)L$H4A8uHT$LL$uAED9AHL$DqL$HuD{8Hc=h)HŅ~1GH5h)H 1fDHHTHH9uHDHH-h)g)HHcg)H\HtIHHx足HËg)Hcg)Hc=g)Hg)HH߃H44-g)HH[]A\A]A^A_@EmMcJD\fDf)ITg)"Wf)H6g)g)11xfDH觠1PdH5Qo) _H=@o)#N 51HfS)t;)} 9~Hn)([HPg)HHn)1H7u;u(x=[)1)*H g)Q(Hbn)1H*);).(| v)u9~(H=f)HtH=WX)/A t*=)E1E1DHAA9}3IcL1H)H5W)LHl$HrAHl$A9|Dcl$ !w)1HL$dH3 %(H([]A\A]A^A_f.EAjD~H=bW)HcH H(tfl$ )1{=)~E1fHuDAD9~3IcL1H)H5V)LHl$HrAHl$D9D~EA@f.AWAVAUATUSH8dH%(HD$(1HD$ sHcV)D5+)H\$D9oH5(L-viL%ǙH=)V)DH=V)McEB|\HD$ HD$OfDH5U)IcHA<.AD95)~2H=U)Dt=()AD95w)ftD95^)f.HD$ L=-iHD$LD\"=/)A<ssAD9~MH=tR)McJ4B 'uAvL| ")AA9|^D9H=R)McfDHT$LT$ 1HL$L)LT$"HLT$H Ƴ)Q@AGAvL )An=))~K+t ANHT$LT$ 1HL$L)LT$HLT$s+H :)uALT$ A )LT$ A ) ҳ)ł1f.)uH g1hH ld1RfUSHHHH5I)tHt :u8tHH[]騿HT$HT$uH%Hx,HHH[]f.US1H1H-})s)螹H9É-e)t H[]@HHxǓHHH[]ffDH5O)SH u [f.)111a)V5V)1H2)\).)豍[111VAUATUSHH=?O) HHHVIHHHHHcб)D%),HH-N)HHx輒HHa1IHTRLHiHtdHHIQ\LLAA9tl9r)~%H}N)?)< t< t 1蟒H1[]A\A]f&IfDH[]A\A])ܰ)H1[]A\A]AUATUSHH5\F)H=M)HT$dH%(H$1Ht|$tTWH5e1DH1.H$dH3 %(H[]A\A]H=EH}HH]h0H=M)|H55M)H=`1E1HtH(L`Hc=د)H$ ^xH=`H?HtH(Ll$?(LH5` HLH=f`1HtHPI9t HxH=O`Ht;HxHt$m t)HD$9&)tB))9}l)fDH=_ H=_ H(t|t1x[1d@}fDy)f.ATUHSHcz)D%)HNA9t99)~=HK)L)< t(< t$[]A\1騏F))[]A\Df.USHH=3K)Ht1HHNEHHHtHFH1[]DSH[]HH=J)EHtH1H@HfHH=J)`HtH1H@HfATUS-)D%6)uu# -)v[]A\A)-)D)f.xLS)5)9u=(t1[fI=ƾ(u)[k)1 ff.xLS])5R)9u=(A)t1[II=f($)u )1[IfUSHHH?u+H;1;HtHH[]fHH[]fHu H5H ( H\@H5\H=\襮H5ff.H5(u:hH "'><=@;|&(H:HxK)fP H.H "'@><@=;|&@H(:H:K)fH HÐATD%9(USt_H \"(HJ)5Q?)H-J)uHtQH9- )tH@H+H…8D[]A\HԛÖ(HJ)fDt<bH "'@><(:@=;|&H0fH @HjJ)D[]A\f&H "'><=:@;|&(H0fP H2J)D[]A\f.HHcH|ۊHuDHI)HtH<@tHuH=I)oDH-I)[]A\@H5I)Hx-Аf.ATUSHD=)dH%(HD$1Et$HD$dH3%(nH[]A\H=_OHMF)H)H5H=+ZHtF)H)H^F)HZH )SH5LH=Z;H5tH=Y#H5H=Y H5H=YH5H=YۘH5tH=YØH5|H=Y諘H5H=Y蓘H5 DH=Y{H5DH=YcH5H=YKH5tH=Y3H-H=YHH5aH=YH5H=YH5H=YЗH5H=Y踗H5H=Y蠗H5H=Y舗H5qH=YpH5IH=YXH5!H=Y@H5H=Y(H5qH=YH5 H=YH5H=YH5H=YȖH5H=Y谖C)H(H5H\$薧H(H5x^~H(H50fH_(H5N H5b(1f|$HL%L9H5<(1HD$ ݥL9tH5(3H (H{ߦH(H5/ǦH(H5Y/详~1Hft$H5(dHH;4(Hw(H5 ~fH(H5X@NHG(H5@6HO(H5$H(H5$H(H5!H(H5@!֥H(H5g辥H(H5*覥H(H5xg莥H5( 1HfL$CH;(H}?8)H0HC)H:HD)HD)H!H(H53HC)HHC)H"H[C)H(H5vΤH(H5`@趤H(H58\输Hw(H5 *覓H_(H5=莓=(HYVHB)H=\SH=B)H!7)H)HCHB)HHnB)-fHB)HB)fH(H5 fH(H5H'D+fDH5( 迒vf.H5( 蟒7D66)DHHL)ÐHL)@HG HH=RHA)HA)H H=qA)HRA)=5)Hpu)>)@HT$dH3%(H1H[]A\A]A^@H5AHYiHHuAHo 1't (H5ZHiHHHHjHx_H'Hx.HHHH$'H<$t )/H<$fH5)HhHHNHx=) !DH5LhHH;~/HHH5zH hHHof.H)H2=)D;H(H=)u@Ht$H]HHuHDH}H]uπ;~tH蚴t=2)H1AWAVAUATUSHH=MH8dH%(HD$(1H$H=m<)HN<)950)HlH<)H<)H+(Hr<)CxVH=9)LcB4'@ t @ DcMcLH)B4'ID$@ t @ IL9DuHL)H9M)D$rH=8)Hc< t< u+JHcII)I9 H t tH=T8)LcB'<(cHc7hG;)1@@"@'D$@[}`D%B(E]lyE1D$AHK)H9L)T$E1A$L$HHH\$(dH3%(H H8[]A\A]A^A_H:)H:)f@ƉD$BtULcB4'@ t @ DbMcLH)$B4'ID$@ t @ IL9DuH,K)H9K)JA}`=)'H=6)H=IT$HtT$H=6)B '&BD'|u >[{u $M։T$-kT$zH"6)B< (hBD ZH=mL:HT$>H=5)B'M,H=/)HtoH/)H=5)E1L=HAƹLD9H=5)Hc|uǀ|>uL9H=H5)rHcЀ<e됃=-)'2HoD%^(D$E*E1}vAfх!ȄgH=4)HcM<(t <`t(`tsD%(EuT}D$`tK4$Hĉt}`u=[)'D$u2(tcE1uA=-)'D$xH5HaD%](HEHZ|$NA+D4$HFE1҉D$1D95)3t D95`)"MtL5H=~3)Ic< t< Eu"AFHOHfTAH t tHIDvH=/3)DAEu 1HHD$LT$PDE<$ L$l}t`Eu9$|V}u D9D9l$9$QED9uL$9 $u EA8D$$ML|$$nH5wH_H‹D$$u F5)H@b~@T$=T$L,fD}`=)'H=1)H=DH{<<X1f.Dn4$H=^1)H=D$";$|$dD9[}u A@D9l$fA:\EAĄJE[@RH 0)HcDD$$T$<MH=0)MD$E}u A+;$HcD$HD0)<D< < D9D$$D$EA8LHLT$OLT$vD$iL$LD$$LDHLT$lD9H))D$LT$M/"LHLT$LT$D$$z|$}D9t}jA`LD$$H=E11HLT$kLT$H()iH5.)Hc  q !cEA8gLH(LT$JH=ALT$T$HT$LT$#A:EEsD9|$w~E1HD$oHT$A,AVAUATUSuTHH=r%)Ht蠿HHxqHHdHHB%)1-%)XkHHLc-%)H+E~L5$)E&D:et[HkH]Hu@HH]HtD:#uLHL訿uH HxqHH[]A\A]A^鰿IcHLruHHxp[HH]A\A]A^z[1]A\A]A^f.SuKHH=)$)HtgHHxpHH+HH#)\#)HtFHc#)HtH=#)8uH貾uHHxpHH[{1[r#)H#uHX/)HU/)@HI/)H6/)DSH=C$)Hۢ豩Hɢ1[DAVAUATUSHHdH%(HD$1H=#)3Ld$虢1LHI蔾Axtt$HHIc:t%t!AFHKH:tTAHu:tVH5A1裿HH1薋HtH虼Ht$dH34%(H[]A\A]A^Av1LH߽y Hu@t$HH ")HHzH5tLHI~H1vf.{H")Jf.)ATUHSt -)t5H53HWHHtH;tH5H H[]A\Ð5ތ)eH52IHSWL9HtLc뮐7@"t@'E@$@HHt1@HHHHHuf.1HtfH?Hu@f.HHHuHHHuH2Hf.ATUHSH>HtdHAf8Et0HH;Ht?Et H t݋C[]A\DHHtHH;Hu[]A\SHHt ;~HFu@H9xtHHu1[HHxlHH[úAUATIUSHH>HtjAH^1A8Et7HH{HtFEt L% tH[]A\A]HL%tHH{HuH[]A\A]Df.ATUHc)SIHcڍ{HcVkI4,HHw[]A\@f.AWAVIAUATIUSHHHHt$HT$ L$8LHÉʼnD$A߻D$ۉD$<EE1E1D$HcE11HD$(IcLMtbEtT$HD$8tlSD9|'L׉T$D)EtIcjMT$IAA HcIcLMuMAHHL[]A\A]A^A_@HT$(HHLT$0L$藸L$LT$0iDD$tD9}QH|$ t'CIrHH)HfDHcHuD$8E1Dl$AT$<@AD9}LIciILhHxoiHHLH[]A\A]A^A_fDAWAVAUATIUSH(HH$L$ t :GE1D$LElIciIIHcD$HD$0DM)AGD9}dMcA<$K>Lx@8HIA$Il$9tL<\uAD$9uID$M)IHAGD9|ED9}LIchIT$tD$ M)D$DD9}=IcIM<6H4$L׶L|$HTAH(L[]A\A]A^A_ED9}LIcMhIzzH贸D$AL$$Lu\LHAH<$HIfIB8D9}2IcLT$M<6LLLT$LIcIjED9}LIcLT$gLT$IfDAD$AD$f.Hcxf t tDD t uHuHDDHHcHH鯺f.Dz|(AUATL%8USH-^x(1HIfDM H94|(~'IUBu݅u!eH9 |(H[]A\A]ÉLFHtЋE߃E@f.SH5Rv~HtHH莶HxeHH:H5E9H=H= kF[)@f.SH=2HH=HH=HpH=ԧH+H=迧HH=誧HHt8umH=葧HHtN8tIH=)HtsH苵HxdHH7H=)H)Ht ?k[fH=q)HtH7Hx>dHHH5<)H=)HO>FH諴9fDH5)H >譺H5)H>}H5)H>wMhH5q)H;>2#H5A)H>1~)[fD[H闳H)Ht8u/H覥Hu)H)Ht8uHSsH@fD8uH)HuDHH5)H>91HH=Ab1HH= LHH=3HH=H͸H=H贸o躲})HH5)HGrHHD.H=)SHHt[HtFHnHxuaHHHc)Hd)Ht8u [@1[@6aH/)f.ATUHSHq;TtvIC[]A\DH=1)HtHtHHx`HH覮HH=)H-)Ht?tHn@H=)Ht臭HnH薰Hx_HHB8HH)SHƿ1@H@u,A<$SH5431HH1z)v[]A\{EH)Ht 8H=H谵HDHA,$HH52I1eLHH1\CX.fHÐH=c(@USHH1HHdH%(H$1迬x?D$%=@t*1Ht@H趨ڃ@DH$dH3 %(u'HĨ[]DH{u蛨f.USHH0t4@u t)t%H%Hx,WHHH[]˥H1[]Df.AVAUI͋ (ATIUHSӅu >~* )L1H?RHIAAuWAA@tA@uH݃ AtH= )! t AEt A@[L]A\A]A^}.I_H= 1LL1 )1LLQHIL9Au&H螣HxRHHH[]D@HH[]pSZt Ϡ1[ff.H'HDf.HHf.$&fD@fDAWAVAUATAUSHH=H萊HH@*AH@DD$  HE1A$LHZHIt$W(t AD$ tLHL[]A\A]A^A_@HAtAHE1fHHxPHHH[]A\A]A^A_錟@HHIt5(u )rL^H4L\Ls $HHIHHIAEA8uHL袣t8)LH(LӐAWAVAUATUSHdH%(H$1H)tQHc)HHHHt -)H$dH3 %( H[]A\A]A^A_HIA)~(H~)HHBH HH9HHuLH) HD$ H5H/) )HHD$谣yHD$(HD$ H=莑HHD$D$H$9H=))HcLHkALuH}AH}~DA3LE~MUSHHtAH=(Ht?H(H=(t% HtHfuHHuH1[]ÐH߉D$ D$ H[]1HtqAGu*OwwLH‰Tu6 u@"u!H?HufDH?HuH?1҅HuDfDSH=E(a9E(~oH5E(LLR1HN0II H0HcHH~MtH6I0MDL9Huԉx IHC 1[L1ݐSH=jE(8_E(~wH5XE(LL R1HN0II H0HcHH~MtFuH6I0MDL9HuΉx IHC 1[fL1fSH=D(18D(~wH5D(LL R1HN0II H0HcHH~MtFtH6I0MDL9HuΉx IHC 1[fL1fSH=*D(7DD(E~]APH5D(LHC M 1H][]A\USH1H5H=i2(HH8>E Hk1 H[]Ðf.USH1H4H踩1HHt Hf>‰S S1H]M0H[]f.USH1Hp4HHEH>E Hk1 H[]fUSH1H04H]HEH=E Hk1 H[]fSH=ѦH=ŦH=蹦H=警H=衦H=蕦t -([DAWAVIAUATIUSEHcHH=LH81DdH%(HD$(1L$ ˍHt @tH(LD;z1HMtA}tA}fDD;H\$ HH=HܔHt @tH(Hc=( HH=H諔Htf@taH(Hc=VH) HH=}HzHub,(HD$(dH3%(8H8[]A\A]A^A_Hc=G) H<H= HHt@t H(DEuH=cHP(tP(1LHHc|$ `(H޺ H=H袓2DMA}A}tA}dLxHT@HlLvH0H=-脊1xf.AVAUIATUISDH臷1HLIr1HLI$IY1HϷHIIt$~ODE @D9t;HHuH=71H芷IEL[]A\A]A^f.H{Ht蒸USHHH=(u_HttH١H92(<(%@E)uUH}(HtIH5E)HH(H[]fDHtHt:Uo(HwHx&&HHtHd(H[]H4@tńtH=A)HtHH(tuM't "o:Mf}\H+ofDHFYH5D)y(HH(fHx)f.AWAV1AUATUSH(H|$H1H8IǽuHDHEDcI|u{z.IH1HD$IH0HHt$uHx$MuHt$HIH[sH9\$IuIEEe H(HD$L(H([]A\A]A^A_f.HD$HH([]A\A]A^A_D1E1-Iff.HH5wHHfHH5vH1HDHH5uH1HDHH5uHl1HDAWAVAAUATUSHH|$tE1AG|=(*(,IƋ*(HcЉHH)L, HI9ttH(HHttD9xuH@L`LtHx #LHqH5HIxHtIcF I6HI9ݍxA~ L$uHD$L0H1[]A\A]A^A_fHfH1DHfHOAWAVHAUATIUSHHt$6@"fD<&HHHHt@t<\uHAHHuHD$H$E1@!L4$A}u+Au HŅAE11IEJ<8IoA;] }a( v( EЅtIELJ48D8uHcE IuHULIxH6} A;] H4|HcU HEHH$H9D$tH oHH[]A\A]A^A_% fD=(u>H$ALpH|$&蔷H$0A~(H$ALp**HAE ~Lt$E1L4$HcU HEH?fff.SHW[f.USHHHoHt0t8t$HmHCH[]fDH}mDH}W3uDf.AWAVAUATUSHHHƒtxuHSL{MA (HILk۱HI?E18AU NIc1E1HD$A8EtoSHA9U ~-IUEH,uHurIIcAH,ЍSHA9U IEg MMcJtLlHL[]A\A]A^A_@HT$LHDD$#mDD$oHDD$yoHxHH%mDD$H`xAxAH(oA1|@AE ~E1IAG H+IAG H fHtH?tG t1GHff.HAWAVAUATIUSH0xA'I$IHtzI|$AAE1L4fDIlHtH.nHx5HHkHIH,HI9uAEIHEo HHL[]A\A]A^A_fD^&fDHmHxHHlkIHAG HB@HE11fDAVAUATUISH1.e@À Ax @ǀT$ X@9t [H]A\A]A^@H=I-(HI1H(LH&f.H=,(LaHIHH(LH%fDH=I,(L!HIHHz(LH%jfDH=+(LHIIHH:(LH?%@3fDH=I+(LHIHH'LH$ÀfDH=*(LaHIHH'LH$fDH=I*(L!HIHHz'LH$fDH=)(LHImHH:'LH?$WfDH=I)(LHI6HH&LH#  fDH=((LaHIHH&LH#@fDH=I((L!HIHHz&LH#ǀfDH='(LHIHH:&LH?#{H=I'(LHI]HH%LH"GH=&(LaHI)HH%LH"H=I&(L!HIHHz%LH"H=%(LHIHH:%LH?" H=I%(LHIHH$LH!wH=$(LaHIYHH$LH!CfDH5lLHI6HHIx$LHM*Lu!H5L]HIHHI4$LH *L1!@H5LHIHHI#LH)L H5zLHIgHHI#LH~)L QH5LHI HHIb#LH7)L_  D-(L4)}HEuHu=(u u(HHHI"HH(L[H]A\A]A^AWAVAUATIUSHH։EHXHdH%(H$H1HT$ LL$0[I}H$t_1YI}1I諫H2)IH9HtH'AFAF H<$L7"LH$;(Mu MlA>bLReHE1E1j1LHIAZA[-H=[LIL1L|$ӦxH|$ InHIj 8E1H|$HL$E1IcLl$Hl$(E݉\$MItA<$L:;r(uxEAHi>;IHE,$M>ME,$1H߉D$ :D$ H[]A\A]A^fHCI^E:;Iċ$txtA$H:H1[]A\A]A^@HLE1j:E@H=uEuHHH@:H[]A\A]A^fDAHg=H= lHtH9DH=Dz|HtH9H5p(EH=tH= HtH9DH@f.AWAVAUATUSH(D(dH%(HD$1EufH͡(g(.SH5HNLty~_Pteuu(ff1 HL$dH3 %(H([]A\A]A^A_ÐuVw1c[ @5z)=o(E1H-R)Aąt (tA(tu Π(HnH}HEH8?-u lu%(nHEH(H8At"H,HItHAEt*HHItHljLu78D 1H#oHD8CH=CHH14H9rH߉$+7$_H5 19H15H=+HHźH5دtʼnH/RH7H=Ov+HHźH5{HH=o+HIzHEH(HD$D$H$fL86H4$LLnHI>AHLD$LI5LSt|$tLuH=(Ht6L56L5L68΄(ATE1USHiH(~OHHKtVLtPt4t*[]A\֝(@s[]A\Ð(AfDH5(H=(H5l(u5H5#l(tEub1H9e(tH4[]A\ H=t11Xeu H95(tH4H=EHH۸!HH1HH5(Ht HtF {k(tH=111duHp|H=H1f.f.AUATE1US1HHMH5HJItuVt`~ptIvu,Du.rH[]A\A]fD3H[]A\A]AfH)1HtEueA A1fHCDH8QuEtHSD$ H:D$ HHu1EfDށ(uvuH=^g|L`HHzvHU0HID$EHB H=HE 1iHAH=QD$ hD$ H=Mr\H="fA|HHL`uHU0ID$EHBs@S|H=i(HgH1=7i(t3H <(Ht9u[[H=h(H,1<D諻H5N1F4H=h(H‰پ1`(*t"H=)`(oH=`(s/[r뼐="(wrf=(ewaHH1}Hv(HH@f.z(ff(Du(T(u HYH92(t 7(fD'(fD(fDAWAVAAUATUSH$(HHLcHAfEuH11L9tWHtH;Ht 'HHtHEL8L+HxLH(HmHHHL9uEuuH[]A\A]A^A_鋋H=t(茣HkEHt(tÐUSHHHtHHuH[]HCH8?-tHcH,@HLH}D)u H4$#t+D{E9~1HH[]A\A]A^A_f.H}tۋEuԋT$  ¸HD@f.H1%HHc(t H@H1ff.HHH0(tH@HD1@H1HH(t@tH@Hf.1HfHc5 'H= 'H 0AWAVAUATE1USH-IHxH\$`Lt$dt$ dH%(HD$h1D$dD$`r6D$ D$$fHL1=5(+LHEӃiCaAFRZf.rnhpl H9WHLL$dD1OL5y(M E_D$8D$<Lt$f.Lt$IFHH\HxcHHHIIF1H@D$(IDd$ EtDZh(Et }- HD$H$t)HcDHL(HD(8+H $uD$D$a1H裬[H4$1HFt7Dg(H5nE9H5}1?HH1H<$Ht)?t$DL$EuFo [LHI1A$@AD)Q(E<L$`/ L $ HHi @(T$d $t R !ȉC(fgcu8 H9L$dDuxt:tHL$hdH3 %(`Hx[]A\A]A^A_@ 'fDH9ڸED$ D$ rf|$ AbfD$$ S H H91L$d$@ D D  @  \$`1Dd$$uM6Mt.IFDH8utIFH8M6MuHD$hdH3%( 1@Hx[]A\A]A^A_fLCL$`=d(ȃD$eD$ 1L IMAF(I~Ht:T$ L$`L$0DL$0Hu L$d D$ 1LIMAF)L$`E1D$ L$0L;L$0IAADMsD$0@m D  D$ D\$@ L$HL 5L$HD\$@IM |$0 Ke(AR( E11AR(D$00fD1E1fD1L֧LvD$8LHD$HHD$H|$@t$8hL$<1Xt$ @;ȃD u L&IMAB(%=pL$`E1AR(DAADDй%D$0tD$eu D$0MDD$dAU @Ate !1Et E 11At A@@\$` @ ЃD D!΀D$(D$` T$(DE%AD$HD$@DDl$d!@AR( M2@(T$H4$LA$[DD$0譯HIA$DD$0c AR(t : L$HD$( ȋL$@D$`A Dl$d!MAR(tAt ADl$dAE!n(L:@H5Y1 HH1D$8HHD$HHD$U1LIM%L$`.D$ I~ H| I~MHLA$[H<$D,(AMHcH|IvHHCI~zH|L-tVEeD$IcHMcItA+LMcNd-H$=8us1A$H@t}HL$$DLIH<$AHcH|(IvHHc[fDHLu1Hk@LyH1\C D$em iD$ L$0LL$0HDP(E1IH5w1L$HHD$0LH1aLT$0L$HIzHtL$HLT$0AR(IBE1AR(D;L$0nfL$`E1@1LVI:fDH= HbH=!HxHHt-XK(HC L$IL$0L$0fDDt$ EEt$`T$$1膼HD$hdH3%( 1E1Izt D$eL$`ȃq\$`/@H5h14LH1'D$<|DDL#ILHD$hdH3%(V Hx1[]A\A]A^A_鴫/L$0IOLD$<H51LH1D$8H5 1tH1jLrQA@t E0DD$deTуCD$0AR(ID D މsEHH#H8HtHXDHOH{HuH H51H4$sLL$H\LHD$0LT$0M Z(A9B,L$HAB(M%=5@ЃDED!΀L$(L$`@@E %AD$HDDl$d%D$@D!AR(1 H5TED\$HET$H4$LDD$LLT$: HLT$DD$LAR(H<$DD$@LT$8LT$DD$@rDL$0D$8Et'D$DD$ H5qY(I:EHD5[Y(^ D$D$( D$HDD$dD$`IzH1LT$0D\$H7LT$0AR(D\$HZLD\$Hn HID\$HMAR(1D$0H X(9H,ILD$8^@tvЃDLD\$Hz HID\$Ht|$0u Z(AR(W1AR(D$01t$$@)hLDL$@t$HDD$(P(IDD$(t$HDL$@ЃDDL$_D\$XDD$TL$PT$LLT$@" DL$_D\$XDD$TL$PT$LLT$@|$H+Nt$(>(RH$H|)AD ى1AR(@D"@L$$HsLCH{ |$D$ t*($ *(HT$Lv($[(f|HcH|$H¾IefL-HgLIf0?HL$HD$XLpHhL`(L(HH L$hHXD$ <D$ H=u( 1D$lMu(D$ D$ t $)(H|$XxD$ u2H|$(1ҾfHeH|$ 1ҾfHeH$0H5t(-u(-Y(<=s(0D$ H$HH=HzHT$pHT$pHDH$HIlH$BZ@H=)nD%H= u((H=t((AtH='(k(H=X(Z(EfH5m{T$lHt$H$R>H1t$8mHH=Ym4&HT$H|$ cH|$(H$1f$cT$hH= 11&kHt$XH=v1%> els(x8US1H)HH1 H߉H[]fDUS1H)HŸEH1H~H[]D1@ %(S@0t%(u ';(u1Ir[f.@S(S(SHH=p(HtHp([fAUATIUSH׉HA"H=V(%H=(%H= %(%H=%(%H=r(%H=V(%H=Y:(%H=D:(n%ADU(H=11#H=ú(5%$(H-o(Ht-HHx HHH=H1#H=`11~#bu}Mtt[Et Ѓ$(t %(H[]A\A]fDH=Q($4f.H=9L1"DH=ab11"n+hH=Th1"fDH=}#($f.FfD=9#(t1@=uT(u(uHfn(8uڃ?uSH1qt1[ÿB_uyH{uHCHxu1C[D?t fHWB- wSHHzRtHCH@H@H@@[fH=Ʊ(u""u/S(Hf. n"tH=]hH*!f.AVAUATUASHHdH%(H$1T$H\$0HhHt$DAgH߃ S(81H1 D]`Ew!(=l(0D$ D$$u l( Ht$H12]-`HD$0HD$Hl(8tHD$(M(D$$H=Kg M(uJD$ ZD$$H$dH3 %(:H[]A\A]A^-u!(.@Q(u ( (2#_fDH=(1 trD$ S~A(uHuID$ uD(E"=7(H=(D$$eH(m (D$$HP(HrH;'t H;'\=l(L2(>D$ ll("f.HD$(HH=ke&HD$(Ht H=Oe D l(l(D$$EHt$1ҿ'fH(HHD$(hD$HD$(8tFH5'e1Ht$H17D$ k(D$$E^8K]Ht8uHD$(HL$H@H@H8uHD$(HH@H@H0=o [pH=DdH<H=5f1H+Ht$(H=c1j(H(t5*3(t HD$(HH|$(WHD$(H@HD$(H@@=s(u#j(tHh(8uHD$(8H|$(I1x|D$$H|$(bHreH=kcD$\H=Gcr2(8`H|$(QHD$(HxmHD$(@^HD$(H@HxJHD$(H@Hx6HD$(H@H@H8HD$(H@H@xHD$(H@H@xHD$(H@LhA}=(t='(u3(I} EN=(It=(u-3(Mte11LXAx'EL\1dHHI&Hx-HHHa(z IHY(tDVc(Eu 褰@D8H5}\Hú1HHL1~LE1=b(~5(u (fMtL腣MtL9% +(tLoJP-:(u('fD1輲v1hOL%*(I>=HEEI>1vI>HI(I>tvE1IH56[Hź1HHH1~輫IHxLHHLF+~I>E1豮t59D(t0E(P%E(u `(t H=ZH;H=ZH&fD (SHD(HH<H9H9H;''|?(HHs+(AHBH41'uEt1ɃH9Ht!HHHtRuH9ƹHu߃H5YtBt1=(uHtr~_($H5Y1H=6(H¾1Wi(t1薒HC(HxC([Ëǣ(fHSHtHGHtH0>-tF$(t0(H3YuSH=(1H=(H[CH=Su[DH5X1HHHHtHWHtH2>-tC(tHHDH5X1H1諨HÐH=fR€uSf.f((((AWAVAUATUSHH>xHH|u>(ku](+-ئ(9HHcH<utHD fHt H8tD7IIA-DA0< Lt7HcILcDHtHH0D:6uLL&uH[]A\A]A^A_Ð==(+-(90HcH<HtfHtM@HgAEALfD1 ADžxLu]ADtfD1fHTfHHzu0u6l(H#+S (9OHDf.AWAVIAUATE1USE111AH8dH%(HD$(1:L=A(LHH(t!H@H81?-1HKH5ULl~@rt{stnntQA薧HT$(dH3%(D H8[]A\A]A^A_Ãt#euHg(HHA(SE1#AAѽfAHL=(t ;-E:1M}fL`HHIGL(LHxLHLHEHx݇LHHHEtH]M?HMt:IG=H8)HpHt H; H0H}H1HMHIGH8HaHQHHDH(HHxHHHI%HHHxLHIHUHuLLIHmMHuL|@H{H+HtgH{HtYHHNHuH= (H"T1LMt,A<$t%L8HID8 sLH5SLWA)蓨HHD$H8D F9(=l(H1fDHNHxu)EAu"X(t =8()AHD$HcAHD fHEt AH8tA9iE.MMIGHt$DD$H8D$IDD$HRH@Ht$DD$H8qED$DD$uD (EmDD$E|$L$9L$E$L=f (Dt$DDt$H\$D@;\$[6(KY6(-EHL$HcEL4t45q (MIH>QLHx1*_IHQLH1CCDCADÅT;\$OH=(HQH1Md{cM1)HH1?H A<$E3 (H);L1DfD=5(e諥HH11EH\$LPLLHHJHH|$ HH|谂LL$ H OHHIH1(H5cOHH=rO5(Ht$ H=1Ht$ H='1H=y11H|$ 9(lH=OA]L H5N1H1艞Ht3@H{H+HtH{HtqHHfHuADD$輟D$9D${DD$D9mL$D$L$HD$IcH<cT$x D$H5M1A1HEtLDDD$ID$1 AD9t$|EiD$D$qEvDD$DD$HT$ H=jME1萉HI8H\$ HHH57MHHD1HHH1H|$ H1EVE1?1HHvHT$H)HH<AwHH9uOLA!ȋL$D$L$H|$ _H|$ d (H|$ HLHLHEQHx8DD$[EDt$8DD$qDD$DD$H5K1H1śoH5K1H1裛D$D$D$1nARf.DAUATIUSAHHH$HdH%(H$17HjH"H1HLݩxW9݄'~WH(HHHtE@E@1D%X'R'ўD%>'tMtKID$H8V1HbH$dH3 %(H[]A\A]H5K15HH5J1sH1fD߾l1HlfD1H1P-f.HHHtHWHtH2>-ts%'tQHH=z(Ht$HHuHHHuHBH8&tiH11HH=B€qHfD1x@@HsHATHUStHWHtH2>-tk5'tIH!u{H(AfD1HADHtHHu[]A\1D[]A\DH=A€y붽[]A\@HHGWH5HH11HATUSHGHH8H{IwH5HHHL1HCL9 tLH9ktH|[1]A\DAWAVAUATUSH Ā'E1E1E11E1HNH5JHHl~;rttUpژH[]A\A]A^A_ftduAfD@pfDH5G1H1v@L%a(6@A'DADH-A(HtuJEuetaH=)(HEW :EH5,|!1f.H=G诘f.E_a(t-Mt(/LSHtLћ@HL-pTuELH&td5LHL15DHmHtOHEL0LHuMuELtGtLD311LLAH='l軹HuLNHuL}L%HHD$BH?%DL誗H|$p+LeL-E5MtHELH1ELML%HmHt8HEH8`HIt=EtHEH5DLH1뷃*'t1HE1H8H-TI(H5D1HHƿ1H5D1gH1xH=9&(H5JOLx,(Ht$L1~H|$$f.DAWAVHcAUATIUSL$@H1HH2'IL$ LsJt H'HLBT"LcNl#҃ UHc:H5HAE>H1BD#'C?9L$ DωL$ H9H!%tDHQHD@HH)9A~H5' AD9uLc|$ H2'1O<IJt8 H'LHBT:҃ UHcDBD#>AEHH[]A\A]A^A_H []A\A]A^A_ATU1S1HPt[]A\8H5tBI1LHH1@f.HcUSHHHH0'HXHtVH3HtN>/tRH-B1H1HH5BIH1HsHuH[]fH{uHxHǾH[]WDf.H=E(S1HH/(teHf'1H)HHHHHcH@HHt HE(H54fDAuAu AHD$0HHHD$0D$(Lt$+H='1LhMIuHt >/Q1HD$XE1H=ѾH !-H5>1IغHD$XHt>8@t61fHt$H<@tH57'HD$X< u׿ mH==QHr'1Ht( H ,H5=I1H== EZHD$XHth8E1HB,@uT@HtKIB<(@t=H5'aHD$XB<( uH5P,1HٺHD$XHuH5I' H=<sH +H5<1DH=<HH +H5+11H r+H5+1H5<'1HH 8+H5|+1H5r<'1膾H讼H=g'Et H|$XsD|$HfLhMI}Ht ?/!H5;H|$X1Hڿ6HD$XH81@E1DHt&IB<(@tH5'衾HD$XB<( uH='Y!D|$DADA=DIuH H)I1IPH5:IH1RIuHu@1dfI}D|$kIUHt$@ljD$LL$LH5[:1HڿHD$XHt8\$@H='8H|$X薹1HfI}H D|$HIUHt$@ljD$L|L$LID|$Hz1H;HB;H5c;A1H_H1H50HH=FANH5A;1轻LHL1L誇H|$HS(H|$ HޅE {H=I'1H5915H1FH=/*Ht 8A(T'D$AF1Dt$HHHD$8AHHD$HD$`HD$@IcHD$ AFD$HHD$(D(݅(蝺HH'L$[1IJt S11HI$HIgH;D$ H|$8LCt$(biLhLHIVLHPHH4Dv+Ht5Lf.Qw HH9uT$LL舺HcLHHL$0EDxH~'BD ҃ D;|$U|HL$0D>DH56H1r~'9L$D$D9D9|$HDt$H~@H5 ' A۹E9uMcHT~'1O$dIJt 11HHD$0買HIHL$0DH9D$ HLLF|$(IW膷HPHH Dv%HL L@ w HH9uDt$LLD$LcLLPH}'BD  D9E|BD>BDH55H1HHH9\$A1f.L$T$HHt$@1[$fD=( ƴH莴H|'H54BD 1 oHWR1 HcAAA~A |Af.AWAVAUATIUSH-61H8dH%(HD$(1HLvtIn(~acdHLˀL-m(0u؃Pt @H-P(H^1[@r~-stwusJ?@7puK "u;HL$(dH3 %(H8[]A\A]A^A_@苃@ ~ÀFAAOHHEH8LH<$D%(-'5(H<$c(2((uD)')(ہHr )5j(u H(1Ld$ EH5Q'H|$ 践H5@' H|$ HtGHmHHELH8kyHEH531HH1H޻HP1Ih(tGD~(Eu;D}~(Eu"D %3(E~#D-(Et=m't QH HH)H<~(1eH5i318H1.XH='轷GHt$ Lkt(Hc 'HD$ H9H U(HcH9H521DzLH܃HHT$1H?!HD$HyHHD$PHHH8HHCHcH|uHD$HH9)HcL|H=J4I?IHcDl$ L5qHlHD$ MH$a(unMM}t A<$MMI'H51I1H*迷H}(t=((AD؄1JLXHHD$  MMA<#H511IH=(IM1=(M}L(MMD=~81Dl$ HD$H=+膢H-I14_1.(1ۅÉ{(v??-(f$(OH<$膭H=(HL⾀o*)Q}芁=\(9NyAVAUE1ATUE1S1HHdH%(H$1H50HOpKltvntXN}H$dH3 %(H[]A\A]A^DstsxtVruAxfD@AWDAGDA7DE!ADH{(HIL$:HcH<tpt1D1#Q1LAHHtYLQL脷L<1LLHt H'HuHCH8D@@HtkHfDHmHtWHEH8%uH蓈x;c'}Hx'HL$MtHEH8虪Ic|$Lm[DIEDH=-DHhIH`H='LHEID$H@AL$  1L-gLc'H=~-ADtAAu1`H5*-1ѬH1xdaZ#aPfAWAVAUATE1USE11HH(dH%(H$1H5,Hatw~ht`ruK@u;H$dH3 %((H([]A\A]A^A_fDy@AqDAaDHx(HLt$L$L|$1@L訮L۴L蓮1LLfHHCLH8tH|$HcH9H!tH 'x HHCH8|1LHHHSfD1uH5'1ɪH@H'Ht؅x;`'}HcH<tEt)BvD9n`'HODHH1J H'H;`'HcH<xA OEt ;1ߌ1SSƲHtHcH=X*H[1u@H54*1襩AWAVAUATUSH8dH%(H$(1HCHGIH- 'E1HAAE11A-AMHD$Ld$ L$HD$`LyM6MtNIFLA<-uAyIQ5H5S)1L $裨L $H1LtM6Mu1H$(dH3 %(H8[]A\A]A^A_f.xuVPփ@Lu+M6DMIFHstCnt>-N?EHXDAHfM6AfDM6MIFH;0u E1{tDH,AM6A]DLHt$LH$H$tLL$IcI9IIFLAt<%:SLCLvL.1LLLx]9\'~]H'HHHtK@@$1L輣<$D|L@tIFH8dx1Lu1L6H=6HHvtH@@$71ADDL $K>荣0L $t&Dp0t <$HDvM6HtUSHdH%(HD$1HHGHH8-tbHl$ HCHHHT$t.HHuHHL$dH3 %(H[]ffH=H€tTxyx-oHHtHCH[DH5 1襤H1pd\Uf.AWAVE1AUATE1USE1HAHx ( Hl$PdH%(HD$h1LHD$HD$D$H5)%HödqgCOcH=p(HtHD$PH~ H9HL$tHp(H5$HDstuH=Xp(HH|$PH Hclj|$H9=8 H5$1Ht$HH1nAH=o(H!Ll$PMDI9AfDnH=xo(HtHD$PHxAL9LfDHIo(H5#1>HH11nf.uKHT$hdH3%(fHx[]A\A]A^A_@Hn(HD$o@H=n(HQHD$PHCAL9}2f.Hqn((YHin(HH@HH(H}(H(HHD$XHD$`D$H')HHD$(@(@T$8t HT$(B(A |$11Hy 148Ã|$H E,;HD$`MHD$ HD$XHD$0tWLt$@Dd$LIƋl$8Dd$Ll$8Dl$H EI9H~HT$ ADLDpHyLt$@Dd$LLl$8AHD$XHD$`AADd$8L$HHT$ AHt$0|$Cl=HtSL$8Ld$XH|$tEtDHH|$HH|$(1ɉLA5'MtDI9}H|$XnO1>H=!1HEH-HDDE(+T$ H5W1BHD$ HHHD$ MH(AH EaHH1DH@igHL$(dH3 %(H8[]A\A]A^A_H8ig@H=NH€#4EHu HHH5m1ҿ1UD$:='9DAuHp'HcƅHE)H5H1ޞH5' }1lHhHQHXHH51mH5x1HWHHxGHH+Hk螘fDHPPEt6H591;H׉t$ =_'H‹t$ HH@f.S*u1-[fATUSH dH%(HD$1H/HGIHH-Hl$1f-+&H=G nHHID$L L4Hx;FLHIݔHHc['H\';R'J1H,Љ 9'D@2Hc 'HD$1H9H HcH9H=HJH5P+-VH9MEHo'uH|SHT'F'='HcH<ɍ121hL%$'LcD$ K,H}蠍D$ S'9~ƃH)HLILf.HBHHBH9uH51:HH1-\^H^{f.SH dH%(HD$1PՁu1<-H\Ht$tkH|$HT$ D$ bT$ t:xF9'|>ut%H'HHHL$dH3 %(uH [fH=gdf1跏USH1HHt x9'}H[]H'HH,H<HHx%>H-^'HHÌHEH[]2'ATUS~R11A(fDHHPHōCH9'~&H'EH' D$ qH<$H5 Wi6rtzuH=W(HR0L$MIcI9DD|$зhS8蜓H5E H1薊HHD1VaW]N3<'\$ H=IW(H該H$HHcH9D$(dt3e\$ntpHV(HD$8HV('{AH$XdH3%(DvHh[]A\A]A^A_Ð\$X7H=qV(LLNvH$HH$HD$@T$DA@WcfDHV(HD$H\$$HU(HD$0HU(EH$t0|$@u(t$Du |$E1DAfH$HtH@H8L$ HT$ HH$H$ HS111<H$ @ <H Bu؉L$xt$|pD$p.7EH$unH=yHH$ tUH$H$HtH$HyH$HAHDID$@Dd$DH= D'u5'4|$装$ H|$8DŽ$&D$tH=711D|$@Eu Dt$DEt5t$H$請`$%=IDl$@EuDd$DEH=Q(1D$hDŽ$裏 Hc$H$YR($H5HH=A̹H$H\$HH+ H螮HUH$6A('bHED$|D$xH$ H$H$1H@H8H$H@H8SUH=rR(uUD$DD$@D$hDŽ$D\$(E DT$E \$(~H=mR([]R(' D 'EuĩogƀH=J1b'l'HHV'Hg>HHHJ'HPH7'H(:HP1]H$H=~41GD-XP(ED$(q$ D$  D$H|$8Dt+D$u#H5^'H|$8dH=M'蘈O(HL$8HCDl$,EHD$`Dd$(H$Hl$PHD|$\HDH$E1H$H$HwIcǀ| H`IcAD$DNO(Ev$;D$E$0 AHc$H$H$N(E8D$ ED$ ~ A9t N(D$'Et)HD$`HHH5'H=޶')|$'DT$H$E|$<D$,|$, D5&N(EN7'5'L$$u \D$ u :'='fˁH$H 0Hc$H$$D$H$HDŽ$($H$H$$$@H$(H$H$@HD$pH$H$H$Ht$pHH$\$lL$(THu2D$L$( H$|$ |$lHD$$t8qHc$H$H@THH9u닄$L$lD$8l$H$Hct$/H9$H$H$H=/1踳uD$xtD$|Hc$D$hP$H$$dh|$H$RD$,f|$\D$,fD=B'C' fD'EHy'Hn'H'rH|$0t(Hc'H'HHN'HD$0Hj'H$HHc'HX'H '$HH~pHIHc. ;'IcHHň AWAHcD|$,Dt$HD$P@Hc$H$J(/ D$ED$@u D|$DEtDl$(E Dd$Esl$(~ J(=' t1 DT$Eu |$YH=药TH1v-$D-'E퉄$n$A݅\t$$PAEfDD+T$ |$H$HcD$,@D$,f.D$,fD|$,HD$PDt$H$|$f.$HL$pHD yfDD$xA}Hc$D$hP$H$UfDfDH=nH$HHD$`HEJH<$H$H$H$8 H$Pv<  H5M>(< H$H$8fDHv< u<t H@uL$$H$I<$`H$H-;L$ D$H$H$H$L訲HI|$hH$ LH IMtLwMYHiM$$Af(I<$ID$HHt&H$8]HHID1Hn uHJH$E*@HVL訿HHH$EH$IH*&-'uH5H=H'11薭\$t H=711~H=711nt$D|$@1h,|$1zHDŽ$yv8$H|$8tHHD$0HD$8D$XD$|$o=''1Hvt$HH1BH= .D$AD$(D$3H|$PasRH|$HmHH @(@tC(H{H$H$1蛿HHt+DL$hHEi]H1HHH$%D|$,Hl$PDŽ$'tD z'E'AE='5D|$,Hl$PA#$H5 '='Z'D$DD$@H$H&uHx-$HHHr=' e$DD$D$=' D\$XEZ$HmH$1H@H8H$H@H8(DH$[$VDD$hEHH=H1HLHH!qHXC(@JC('D$L$$H$H@H8cIH$}hD$hH\$H9}CH$HH@H8HH#H$H@H8/e(HtHkpH$^#H5j16sHt$HH1'?H$*#%D|$,EHl$Pp8L$$O'g'DŽ$u 8($ńA|$H$H=q1豅HhHB2HHDAH$H$ H$HH$8H$H݋L$htH\H-1ZH5'=' 'VH==(xH$_D$DD$hDŽ$D$@IT$hH$H%HH$`'$HIH$LH@H8}LHB!qD$|D$x'u@HH5'=' 'HÐf.'fHHHtHWHtH2>-tCHFU';'uOH5D1xpH1n<H@H=&€uH='{vf.H1-r'u,H5dH=1'H=[1H@H=ݦtfH1-H=ˤ'R'u(H=DH(H]AHtoD:;uHLluMcH-/&KHDxu]H@ Ht T$ HЋT$ KHLHAHtYT$ LDЋT$ DLH9H[]A\A]A^A_DT$ T$ uL9HA1A-f.AWAVaAUATE1USL-EHp&H8IdH%(HD$(1LD@HCHLЅtLiEtELkHH(Mt#{EtHtDEt@A~H-%&HE1L=HcIIHtCHEIH(HA<$tIcLIL@fLxhDHDpHAD:uELt AMcKD5H=QHt\X(H=LڃP(1 {P(5w'уH(ttLHD$(dH3%(ueH8L[]A\A]A^A_dH=)1LzP(уH( 'ttP(f.H8hgff.ATUISHdH%(HD$1D$Hl$fD-HHdHL0HHuHD$dH3%(u H[]A\Jgf.t wSH=8sPHt@P(ƀt8Du3HXHfHxHHqdHH&H~c['`''1(''AWAVAUATUSH(dH%(HD$1HH-B'H }HHx?itu莡/2(H|$D$ifD$5}3HL$dH3 %(}H([]A\A]A^A_D+fHHtHIHSb't)183=$2(?EDeHHtHGHb븐D$ E1HCL0A<-D$>l$XEՃ+AŃEfDIA>Ati?oL;MIGH0HxՁt}tyu7IA>LAAufDHH?ED$ D$D$}DYA=DA%DA|$ !7D$ 11 @AFtaE1<--A~HH83D$H|$D|$D$D$2%1H+xt+veHuD$ bcH7D$ ff.AWAVE1AUATE1US1HH8dH%(HD$(1yH5HSuftm~ntVvuAAϐu31HL$(dH3 %(;H8[]A\A]A^A_@#0@A{DlfDAD!L%.(DD$ ؉$DMD$ol$ Dt$Dl$ D|$D='"L*LZ1D$M$$MgD$ID$EL(u1L|At[LAbHPHT$ L辉tLJHIAG) IA8E@IT$AG(%E|AHt$ LT$T$=\$utD$ l$D EkM$$fLxQHIE1M"T$XD$ VۺLT$^uT$tAuf.L蘈n1LNHItsEw(A t$Dt$@L- HLDM?H51_LHL1+D$M$$T$E1xL$T$L谊T$ŃuE1fID$H8T$1@LT$OHItd@(T$=E苉T$ŃutD$ Lg\ID$H8H1LfMHIt @)L,H5q1=^LH10*D$M$$fH51 ^H1*fDD$AG(DTM/H51]LH1)M$$<@HLHL$h`HL$LEL-Hx1tXML]Hx LHM[Ht$ 1HI;HtHt$ H L?ZI\{]l$T$DO(HDEȃt5:'taDG(HJA@tADG(HcHADtfw(HcH@tiw(HcHtnw(HcH@trw(HcH@ƀttw(HcH@txw(HcHtcw(HcHtlw(HcHсt uHcHtaDO(HJA@tADO(HcHAtɃfHcHAVAUAATUASHH HHdH%(HD$1pG(At EEHEHEH5^1DaC(uW@EuFu:H{Ht1(&HH5SHH1`HWfDtH;X1HL$dH3 %(%H []A\A]A^ÐE 'u-HwH?AVHX' EH't|H5xH1N`f1H6]1HMEtY'1H;HsHXH51_HwH?HWAu<$fAHBYA$fAVAUATUSZI1MteI}Ht~MuL%H-fII~Ht[H̾'L9@H9 @b1[,tǽLU[]A\A]A^YIu1@SXGHǸHt0HT'HH9HH9Љ@ 1[fSXIHǸHt0H'HH9HH9Љ@ 1[fAUATIUSAHtAHH[]A\A][HH@*HXHHWHxHHUIH}1LjHHE(H}% C(C,u AM( tK( D e(|LLTs(D s( D#p(p(D + 'H[]A\A]L(?HHt8p(@,t s(D s(DI"1LNFH'H911LiHHТ's(<s(.HL[]A\A]^SfD>H9tM( C,H}f.AWAVAAUATE1USE1HE1Hh4$dH%(HD$X1 mD$H5Hha~@ntsptӃftI#HL$XdH3 %(Hh[]A\A]A^A_@t#AuD$@AzD#@AZDAJDH-)"(H$D$t '$EL$t|$L$D$D$Dl$D$LȉD$HD$@HD$PHD$ %fDHL,L|AEA?+H}~AE=1ɋD$ D$DT$A-gLMHEfDD$PEtD$Rr|$t HcD$LDPxt$HcD$HDPaHcD$@H|$ L$DLL$8DP5HHHD$0襓HHD$(8LLL$8LD$0\$LLMHt$(HPL$DAEtA4$DH~HmHHEEHu51H[H{uH#D$H8DHIǺH5oD\$EtFE$A!G(qL$@T$10Eu$A G(1AH<{AE=A+"DPAtfDH߉L$(L$(T$D$$L$^D4$DD GSAHt&AD4$$2AD‰$1HGH;LsL%PH-9HH\$DD,$D<$D|$ۋG(ttOEt@tFt6At1HH'$L9@H9 @1$II~HuH\$1H߉$ON$H_|\H5|1QHH1D$oDH D$XQH$@D$࿃@D$H\$]Qf1Ҿt@1Ҿd@ATUSHHdH%(HD$1HtHGHt H0>-[1HH%91H<$H$HH9H8'HBHH$H='HtLH'HPHHH9uH-'HHEL LOHxLH}MH'Hߙ'HHHҙ'HEuH$\@S1HL$dH3 %(H[]A\&(t)H51O1HtHSH:H fDH=蠊vfDH'KOf.H'u "u)p'tEr"HgqfATUSHH<(HDp'HCEH(Dq'E/HNHHNHxHHKHH=H=1H蒁H;t<oH=11wH;J"'tH;p!AapY1H;H@[H=)D$ ׀D$ H[]A\f./HMHH~HCH(D 'ED 'E1H虁H5WH1LHH1HCH9(tHI='t{5%'uq {'ug 'H[]A\fHH[]A\f.HhHHMHCH(-H[]A\fAFoL%(M'wLKHxLHIH=IH1H=eL1oAeg'H51mKH1cN!@H5A'oDf.ATUE1SHH:bHH]t:t%ft[]A\ÐAf.諆[]A\Ðb'tvEuAH=(5W't+H5[1JH1H5)蟓=!'HU'O1[H51=JH55f.SH dH%(HD$1HtFHt$|$HH=H߉D$ FD$ HL$dH3 %(uFH [Hi':[uҀzuH5IH1IfUSH8dH%(H$(1HH$1HPH޿PH=}'H1H5}' IH=|'Hu1H5|' IH=|'H1H5|' IH=|'Hs1H5|' vI1H$(dH3 %(u H8[]HfUH(SHcHH,HHtlku H1XSutUH|HH5HHE1!NHtHH[]DfDQkuH[]fDH=H€uH HH5ٿHE1MHHHWSHH=H€t{'$H=H€HHHHH5HE1%MAVAUE1ATUH-S1IH^HLYt`lt+ptNt)H[]A\A]A^cH[]A\A]A^AfEH-f( HHEL(MtA}z'HmH\AEAt E1<-U'L5#DA&cHmHHEH8IVAu‰ljD$ aD$ wIcL)z't襎뜾蔎닋 z'_H5sgfDCN`HuGHmHt?HEH8UuHEH8yfDuH[]A\A]A^.fDL\fHEH8f.14 +f% 'fLl5x'AEt(<-uRAEuIHmHZE1A HmH?AH5LbTHEAHHAE댾LA$T:fDAWAVAUATAUSAAHH(A Dx'EE1H.x'1pEEc`H"HteAAW=Ew'H5w1BHHƿ1HAA`#E1HtEt EH:HItr1t H{@LAJ?H(D[]A\A]A^A_H=iD@E[H3t+EE1D$%D$؃D$D$؃D$TfD|$t/D$ALE>Et$EH}IMA:U u'nL>A?/lT$`T$L1ALI=D$MD@H=nE>L=EFAkDDHI>[|H$HHD$FHL$IHf=HLT$CT$LLL,=EE1kH51?LHH1F]L>MfD賡HaaEE=fDs0HILEEuOE,fDH=ιT=H0HIfH=$=HEqY@H@AAEHALHH1PDH HH5>-HxH5eIHH1DL:E@HH5-1=HHƿ1CofDH51u=HHƿ1CIwHBHz;DH=d;H=ƷAF;H8;H(;LpH5@1It8HcL1HH_HD$HdH3%(uKHP[]A\A]A^H=-,6f.H EȺ@L1Ah88AWAVAUATIUSHXdH%(HD$H1='uXAaS'HH5&fD'dH'cDH HD…@8HH@;@D o'EL-7'11U'4NLLIAAHAAA?uIH\$HdH3%(xHX[]A\A]A^A_fAStRAau Ν'ĝ'H=ŝ'9}qHcƒ'Hf(HHD8HPG<rj$Y'\HU'Hc='H2'HH,'f۸AdDHD$(1Lt$0L=&H$.@ttHt$(DHE~iHHE$H4$LAt38tH>HH .&H=}HH4H15Ht$0f1;fD5E'Ats&L 6'E!Iy1DAcH&dfD9H H5+14DH1H(L ›'1HAftHBH'IAAfA[fDD9}D'HL@۸D|$EÉl$E1DD$ HD$(L$H$HD$ IfDLHLȋ0LpcGH&E1dfD9tH ADd$MhH$LDAD&EtItPt$tLL$0L$ tLL$8L;6!>.8E1l$|$ uLL$8L9L$0vID$u륋T$It0@H(dH%(HD$1u D$ r@ǀu HcЃD w@@u HcЃD xHD 1@ u D$r@u HcЃDw@u HcЃDxHD1@u D$r@u HcЃDwu HcЃDxHHL$HT$ LD$H5D1z5HD$dH3%(uH(/AWAVAAUATIUSH-ƶHD1@HD$H@HPЀ wLH0RiH|$(HcH9X'`'耉D$T$$''D$'fHh,H2LS,1LH&&H|$ x6A9F~5Hu'HH<t%1L%ZDtHD$H@H81L%HD$HHD$T$$'''<'H‹T$$z'x'HD$$i'O'M'RD$T$$8''D$'"j(f.USHHHoPt;1HH:HHtB(@u%1HH[]fHhH[]ff.=6'('Df.AWAVAUATUSHHdH%(HD$81Ht!HU>H5H9tIt4H\$8dH3%(HH[]A\A]A^A_Db@H='Ht$|$HÃHhLhDDeA:u&H|&D$ A>H p'1H^'HDH<tHH u fDH GHuH$gH$IH1H4AHHtHH1HOH uIPA H Gp'Ht3AFMcHI)K4fHQH AHHHHuIcIH҉uKH5ً'HtT>qA:H5ZLH=OlVfH5ZLA:u&Ht$H=1D$D$6fH=OH5aZLpH5ƥLY#W'1'1f.SH5%H1 #HH1[f.H藹1HHJW'o'o'u1H@f.&t n'1@HH=W'X}j&n'1HDEfHa1HAUATIUS1H&H5bHD'DHHsHt(D:&uL$uH[]A\A]f.H[]A\A]@f.t+HHH5HHD1'HH H5HHD1'fDStW''''''HH@H&HDD i'EuXDY'Eu<=J'uR5<'uX .'u^ '1+&fD& 1[f1&[f1&([f&)@&*@AUATAUSAAH &H-HH T'H=kfDHt%HCH HHHEu1DCHuH1[]A\A]mf.''fT','vl' 'r''T't&:''v'lj'S'}'&i'',i'N''&&S''''&@&:&'f'HS'&D'>'\'&&8''f.&''t'n'h'_' w HWHcHfDB'@'D'D 'D'D'DAVAU2ATUL%=&SH-L5IŸ!f.HIIqIT$HHxpLHIDHcHHuIDL[]A\A]A^Df.USHHtCHxWۺHEH@HP&HHDڋ0H1[]fEH[]fHXH[]ff.AWAVH=AUATL-USH-&E1HHIdH%(HD$81LHP'HUHELHIDEt &EtHMuA~H-&HE1L=HcI@IHtCHEIHHA<$tIcLILxLDHDpHAD:uELt AMcKD5H= HtdX(H=LڃP(1X.P(5g'уH(ttTHD$8dH3%(uTHHL[]A\A]A^A_H=*1L-P(уH( Ng'ttP(DHAVAUATUSHE1L%&.fDHH@IHP*HPHtH8HHt0HCL0LyLAHHuH=jHt[D]A\A]A^fDE1AWAVAUATIUSH-61H0HL,tip8~6suqH[]A\A]A^A_ÃouHL$,uL5W'Zڃ s؃ML%&tnM6MIFL(L_HH@ID0DuLD{TA1ۃ-f.IFH0M6ADMuޮft1H[]A\A]A^A_nމ߃ϪډH5r1H111MCAAL=A+H5H-1M6MtIFH8誩ADEuIVHuH H52ID1J명AAH-ê&AAL%IAHK'H=A@HUHELHIԋ0A9uEu MuIFH8F#HL[]A\A]A^A_LYlXމǃ?GH[]A\A]A^A_DUSHsU1HUHH|H߉"H[]fAUATL-&USIHdH%(HD$1D$Hl$ADHpx(HH@IDHPHPHt H8HHLJHHuHD$dH3%(u H[]A\A]ft SH=Ht@P(ƀt8Du3HXHEHxLHHHHH[AVAUATUSHD'AD$' R k't=k'Uk'tQuH=B>'HL$(dH3 %(H8[]A\A]A^A_LH*k'uG,k'uRAtW=q'Hhq' ft$&uH5=' j't=j'H51'H51LH1^'=^'?Izf.5Je'He'%f$}L$L^'^'IL,$l@CWfD=R^'H3=B^'HgCkfDH50'%}f.HD$(H\ffHt$`HT$PI~1HD$pD$x)D$`LcDL$PEHl$_L$/L]'uf]'uLH9D$P~`|Dc'Hc'Ƅ$E@$uH50'fBf=]'uGO,&MuBufD=\'EGQkBfD=\'%GAmLE< wH+E< vD$D$ tEl$ATA?uA%XAGfEH=b'HHKHD$XH=7Ll$XLWHL$HLL3LH$H$Ƅ$sLf; H!%tDHJHDщHL)3Ml$xLkFkD$4LD$0$Dt$a'Et$LL1kHH=-'3Ha'HsHL$ H;eHD$(cD\$Et$LL1ItL$*a't$t$Lt$,1A_ZL1ILHD$XH/L$LƄ$M;H$,$<$Z'IMl$0H\$@Ll$HMA$LL)څt$DD$4L$LLL$=L$L躦''@If}LL1,<$T$LL1LL$4T$EL1-L$4T$ML1t$t$LL$DT$,1^_DT$0E7t$4LL1LwDt$0Elt$t$Lt$D1AZA[BD|$0Et$4DL1DD$4L$LLH=*'NuH=)'I W't =W'dAW't<=n]'H5_]'H=]'H=-]'H=6]'HDD$4L$LL -H=F)'LY[V'YV'S=\'_H5\'H=\'H=\';@LL1IGH8j\'L=o\'<$T$LL1|t$t$T$,L1AXAYXT$DL1=ID$E1H8M['L%['`DL1t$t$L1^_T$4LL1LL1Hr'HD$XT$4DL1~t$t$T$DDL1VT$4LL1;IGH8L=Z'LL1Q ID$H8L%Z'S'tA9=*Z'tH=Z'H5Z'UH=Y')H=Y'v"H=Y'`HY'HY'H=Y'H=Y'HtH=&'Nu H=%'S't =S'i=S't8H=%'hY'eMH=%'usH=%'5Y'HY'HY'N=Y'X'^R'=PR'X'LcA|$ IH׉IL%%X'X' M--&t{uW'HW'HA: фɉW'tk&?;fDW'HW'~HcȽH΀;-tcH[]A\A]A^A_f.x:uHcW'HcHW'H:H0W'&W'H/W'DD{A-tEtW'H@{uV'a@H58}I1H=K#'AHHپ1?a!@9D$ t"PIƉV'H~V'Of&uFHy-&1HPV'A}:@ōl:fD=.V'H5|I1JH="'HAHپ1ff.H=U'tHcU'HcU'HHU'Ðf. &fDf.H H{U'@HgU'PzU'P HhU'HPVU'PHfDHH6U'G)U'G fHHq<:H6.<-t<++fD~H'H S'H=տ&D5Ͽ&EHS'HBHS'S'H<u@HS'?H'HHiS'u"H[]A\A]A^A_fDH]'H?H^'@D-9S'H"S'AHKL!@<#AD-S'McC<,uHR'HR'H'`H5ѷ'H R'R'<EL$EAH=w`LA-A|$HHVR'Hl'KT<ulHHH@1H8HR'HHPHHHQ'H'|HH5'HQ'f.0< HHö'HQ'8<;H=&@-&?x~Q'H{'HDHMQ'Hf'@H==&D57&?HQ'H'H 'H'wHP'H'[fHݵ'HP'HP'P'@AVH5wAUL5m&ATIUS1D'HHHI4Ht$D:&uL%u[]A\A]A^fD[]A\A]A^ATUHSH5v1ICH]@mD H]pG @zǀQ%@{@RÀ) V* H}Ht-褱HuH5uHH1HH} Ht-nHuH5uHH1HH}(Ht-8HuH5uuHH1xH`H}0Ht-HmH5?uHH1BH*H}PHt-̰HuH5 uHH1 HH}@Ht-薰HtH5tHH1HHM8HtHtH5t1A<$_tL[1]A\DH=Cg LH=:k LuH=Ut\[1]A\DHtH5s1&HsH5s1HCYH5s1HsH5s1HsH5cs1_H[eH5Cs13H9sH5#s1f HhH5s1FHXH5r1&HaH5r1HrH5r1fHrH5r1=H^rH5fr1HkH5Fr1HkH5&r1fHqH5r1FHqH5q1&gHqH5q1>HqH5q1H%aH5q1HOqH5fq1HRH5Fq1H qH5&q1fqHpH5q1FHHpH5p1&HpH5wp1HnpH5Wp1HEpH57p1H pH5p1tHoH5o1KH=zp[1]A\f.HwHUSHHt}H1fDHSHH:HHtEHCH8ŏHuHCH5ep1H(H1HĬHHuH[]1H[] fUSHHteH1fDHHtDHCH8uHCH5o1H(FH1H4HHuH[]1H[]DAWAVL5e&AUATIUSHIpIE11H8HT$HL$HD$H5ioLc=HcHH'1Ld$(H5PLl$ HDH$EfDHHHI4HD:&uH<$ uHcLl$ Ld$(HIcDI +H8[]A\A]A^A_I&fDI@IMPAGDMSAfDH-'HHHH pc&HHcDH D$mDI\@I@L@I<@I,@I@I IIIHɪ'HE'DH'HE'DH'HE'DH'HE'}DHi'HE'eDHQ'HRE'MDMAG 2fMAGf.H'HD'DH8[]A\A]A^A_H5k1H4$H1跨H8[]A\A]A^A_HD$HT$L(HD$HH8[]A\A]A^A_H=k۫V>H=;#H٫H=Ik蓫H=1kxfUSHH5&k1HHHH6j@H5'HtHHxHHHI]8H>'HtHHxЅHHuHI]@H>'HtHHx衅HHFHMI]PtzL1AHELH8 HmADHuL"O]DMLgLN8E11Ht諣輂1AUATUSH8dH%(HD$(1H-HL$ HT$1HD$ HD$HL='HI='HF='HC='H@='H=='H:='=H'L%ŔHt H@HtL H=<'tH5d1H1賠H=<'tH5d1H1茠HHD$H-<'HCHD$ HHCtHHx菃HH4HHkH-V<'HtHYHx`HHHHk H-<'HtH*Hx1HHHHk(H-;'HtHHxHHHHk0H-;'HtHHxӂHHxHHk8H-r;'HtHHx褂HHIHHk@H-S;'HtHnHxuHHHH5GHkPE1E11LHmHHP HD$ @tHH5JGLkHI跌LOdLHtHH}t E HD$ xD$ H߉D$ x}D$ HL$(dH3 %(|H8[]A\A]D1@HD$ @t1E1111LIHcLHؔHu;HD$ u+|H}\1H+1PO1} uHD$ AWAVL=V&AUATE1USE1HH(H\$Ld$D$dH%(HD$1D$H5`H$=d'-LHEӃD~BEH$}ouhH!'HHD$lH$-HHAD 뎐u3 HL$dH3 %(QH([]A\A]A^A_@賞@A:DA*DEH-'H=vVEHE1L5_1HEH8$HIt$D|$u ELx1DLxHmHuMLIH=Qm 1HHIH;'@Hš'Hl$Dd$u EHߺ|w1HDow1w1DwqfHpHEH8`3MLHEL1H!H1H޻H5+_1H1H|$tH=ș'HsHD$dH3%(u%H(1[]A\A]A^A_ H%1DH2b1HOt|!<.t-1>.u.t\u1.fDVt!.uNjV1Ð.uf.HtL7@tFHW14HHc@t%@\HupHcIЈBHc|uAIHdH%(H$1HHt>!x=D$%=@H$dH3 %(uHĨ@@AWAVAAUATAUSHHdH%(H$1H<$zAH3HILl$0EL$HI4$HL u؋D$H%=@uM<$L pLIHD/AVI$H$Iō@L#)ue|HWHuSALHA)HL$DDAH1ALDAH|LHIHHuI9ݸHL$Ef.AWAVAUATAUSIHHDUu`B&u6<.t<\A<$.@1H[]A\A]A^A_DA<$.u<.t<\uӀ{.uɐL{LI\1LHH\$HHHH$tH9udHD$8)uZ|LeHuHH\$DLL*)ZDsLCDLIDs0H4$|LwHHHuL9|$ {.fAD$<.A|$@SHH dH%(HD$1HtMH|$1HKHt8H|$H LYE1HHrtF!<HcHHH\$dH3%(uwH [fEt[D$ MD$ B(ufDBHrt0BHvf.BAH]BHQ1Lff.UHAWAVAUATISHH(dH%(HE1H?ALHH(*HH =K&D|+'Et =6$'t DDDž%DžDƒDDE1LD艕1M牅#'#'AH HIH8t|IHvDLLuDLLzt5H(LlDHHA{HLHHVHH2E1E1HLLMDIIL,DIt$LpMLDHHMtMgIHuILHMLtfL'MLuHHDžfH(1H HL$HHI HMIGHI|Dž1ۋLLI|f.HFHH6HBH9u싅HItPMtKL9LtL/Mt6L9LuH$DH(12fL%'HMdH3 %(LHe[A\A]A^A_]@A<$DžDž1*f.H 'H9t Hl@HHHDHHaD`McLHHt HHLtHHHHtHHDžH u`H(ԾD`McLIHIMLpL8>AMhMt5E1 MHt(II9ID(M'LMuE17IM?MuDMtLMtL޺@At HƺL޽LH#HL2=H Lt$IL芽HxMIHHMFLLIOLHPLLyLFfDMA<$E1DžDž?LDžf.H(ļ|IHc{IHcMHkHbLHGHH(L0A~IcHAD/HcLH0LaLH DžHL$HIHHY1DA~H6HIxEN@HIHD-HLLHAHHH1LLff.AAqH(LL~fMtLHHHIHLDML迷HHۿIDI$LH4LDHi_HE1TDžYMLtLL*LMDž8L+^1AWAVAUATUSHH8t$1H9H/HIHI 'LH)DpHH$޽HHEHHLI\$輼EBD=UHUuA|$HL!D$ HH"HIH'I9D$AT$LHH3IH踵/H3KHIH-ZxE1;H'H$LqD$t ;*H5#H߉L$bH;$IHL$Ht HH-wT$LHwEI;H8L[]A\A]A^A_fL蓽HIt3!HIEUE=IEEE1f.{*E1{u] ED$H5Euc='uI?'tH5EHEDA`D='MHгfDD$ƃ%D$(XE1IAFLȀ8/uLHIHD$胳M=H{'H9D$H$aHD$H0HbEt A|$*jD$L|$1H\$ ALd$%D$LMIT$(tHD$x*y>D$uHD$xvH|$ HIH;$D$,tHD$x*I}T$L1IHHDt1PI|HuB42HL"HIIEDHt(f.VNIωЉD)IDHuAAFM9ILuHL$CHL,IuHHl$MH}Ht1f˱CH|HHuH|$豱@L[HIL<$LHIEFLHHȷH`}*ImADIcA|/A|*A|*IDD!DJ~x*uH׀x*u ʀx/tމщD9AE1#A|$*A|$*A|$AL舰x*l$>H5/xD$,?HD$x*0x*&xL@x*c@t/1DEt|t A9tfDL9t$}D$ t .EEt1t E|$IL$A!A^ˆT$WxD$ Lal$4Lt$HD$8A[1DLD$ AԃD$0A\u |$8ED蠨D`EAdHED}HD$(Dot D3AE7A/u |$0vA-DMA]NA\Leu |$8E@A[E<$zEtDDL$(DL$(D1DDL$(IDL$(~:A]HLt$H|$WMf.Ld$(E|$41DDL$(DL$(yjA]tA[A$=U:.[L1[@EHEED}HD$(f.|$41D@l$4Lt$HE|$EIT$t$ [Lbh]@t \ozL@E_HEED}HD$(f.1fC߃HDl$ LD$LHL$HT$EAL9t$@ED7fD}E#H9f.|$41DA-1Hl$(fDELd$蛥fDIL$E|$yfED_tDAdDAM|$41DLd$(k:HLt$Hl$4D;!A|$=A|$ ]EA\$tϤt 蔨Ël$4\$dID$E|$9EEI'fDA.|Ht$dLDL$dIAD8PfAD$D$dIl$II҉:AWu]uMM)L薤HHeLHHHHpH=9BD3H\$hVHLt$h H55L |$4xHD$dMgIo 觜E<$ECA]Lt$HI@Ht$dLL$dHź[AMD$4Dx;@Le DML9t$@D$ A~/fL9t$@ABA~/7L9t$@A~/DEIDl$IDžL9t$u |$$<D/2Ld$/LLL)HEզHHIDAu \l$ t$PtDd$ DSL9IGDd$$ADl$IEtA?(tZAwH=3HuE[t@L$PAt׉T$$股T$$t C9T$ tIL9wDMtMtDD$HL$LHt$L4u1^fl$4Lt$H[>Ld$\@Dd$0l$4Lt$8cDl$xDD$(EjA`HT$/LL)HoHDD$(MgIo DPD$ D$4E<$DH_AD$ ]IDB=H@$HL`DLBLGHD$L9wDIL9 A>/uII~MHL$Ht$EL@H51L٘D$0uH>1HD$hIHD$pLHD$pHD$XgI菛LI~ҟHHD$(H|$h:IbLH|$(HL$XHt$hIV趚HH|$(s肝H|$(IMtmT$0LuTDt$4DhA_ H߉D$dD$(חD$(MwMg l$4Lt$HE|$4uHD$d蓗HT$1LL)HHH1H\$D$ /2BOBHVLt$@V!DA?(LD$HT$IOEL!b1|$Wl$4Lt$HILM诖f.AWAVIAUATAUSHyHILHH9(HEI9t31LEHH$tAE߃w4H6HcH@I~HLH)H)HH9\HH[]A\A]A^A_L9wIFHID$L|$HD$ DDl$Hl$Dd$D$(@Ld$ 2f|HLEH4H9,$UIMD I9AuƄt 1fDDD$H|$HHL,uL9t$s@DD$(IL9t$\HD$A*D$uIFMnH\$HD$0DD$(HD$I9|HLL9HD$ HHD$MHAD T$EHI9EuHL$ELHHHuDT$(H9ECHtHL$H$ELHDT$8t/H9tHT$0HtDT$8HL$LHEt1HH[]A\A]A^A_HD$0A?D$0u^H;$IFEH\$(HD$LHEAHD$8HD$Ht$(HD$ H9t|HHD$ H$H9T$(t L9HD$ EH\$8HH|$HD$AD T$0EHI9rgH9EEBEuHL$HT$EHHD\$D\$uHtHL$(H$ELHD\$HI9sEHD$ H9$HD$ D#E/EE AHWD#E/HH[]A\A]A^A_f.DD$H|$HHLL'H9,$ML9t$DD$f.H$Ht$HL1Ht$ H94$Ll$ L9HD$HD$ EtAHlH_ HRD#H$EHLHE1TH$EHLH!=10fAUATAUSHHHHHL$HHLEHLH[]A\A]fAWAVAUATUSHHt$H|$PdH4%(Ht$x1H9HL$(DD$ fDDI IՉl$`D$8IEA]HD$t!HDXt HL9|$E'Dt$8Et A}(?/[\HL$(H9L$_D$ lA]IEH9\$>I}膜T$L0ADVHT$>XHT$H(*D$ Mt A. Ht$(H9t$AnI^*t ? D$ A/D$ AuDl$Lt$(Dl$8G?tk*I9 +HC?t * A/u |$CHEu?uE-IGE1H9D$vEgID;(uDL$ HT$MHL?t"H{I9t1LHHY1f;(=HD$L9vDd$0l$uLJuALt$08H=&DHcHH|$hH8f|$<_ ÃL\$tMnBInHLD}EA]l$ L|$XILeDM6fL9|$P-D$ A/f.L9|$PD$ A/ f.L9|$PA/Dt$ H݅@IƅBD\$8Et L9|$t$ /Ll$/LLL)E3HHIDD$ u \DADT$`EtwHEBD`I9MfD$ Dl$ MI܋\$8D$tA>(t{AvH=U!2Hue[t`ADL$`EɈL$ t1L$8T$ HL$8DPHT$ tАHT$ H D$ 9tIM9uffDMtMtDD$HL$(LHt$Lu16f}] DD$ DeEtbHBD`t BHF$|$<1DDd$t`HUD}E[l$ L|$XDd$0l$(DL$ LD$(INHT$L!hH1Ff|$ HՅ|$gl$ L|$XMl$ L|$XIDAWAVAAUAT1USHIILHH9(@HL9t21LEHH$tAF߃w,HHcHI|$HLH)H)9cHH[]A\A]A^A_L9wID$HID$L|$HD$ DDd$Hl$Dl$D$(f.Ll$ 2f|HL0EH,H9,$MIMD I9AuƄt 1fDDD$H|$HHLluL9t$s@DD$( IL9t$\HD$A*D$uID$It$H\$HD$0DID$(HD$I9|HLML9HD$ HHD$MHAD T$EfHI9EuHL$ELHHuDT$(H9ECHtHL$H$ELHDT$8Wt/H9tHT$0HtDT$8HL$LHE,t1HH[]A\A]A^A_HD$0A?D$0uKH;$ID$EH\$(HD$LHEAHD$8fHD$Ht$(HD$ H9t|HHD$ H$H9T$(t L9HD$ EH\$8HH|$HD$AD T$0EHI9rgH9EEBEuHL$HT$EHHD\$+D\$uHtHL$(H$ELHD\$HI9sEHD$ H9$HD$ D#E/EEAH蛃D#E/HH[]A\A]A^A_fDDD$H|$HHLLoH9,$ML9t$DD$fH$Ht$HL,1Ht$ H94$Ld$ L9HD$HD$ #EtAH迂"H貂H襂D#H$EHLH1gH$EHLHtP1CDAUATIUSHHAHU}LHJ}HH4+I ELH[]A\A]f.Ht Ht@f.H9tV1Ht Htf.H9t1ATUHSHHAH0dH%(HD$(1{Hy|Hu3Ht HHL$(dH3 %(H0[]A\H|$1HqHsH|$ 1H\HHt$ H|$HtcHt^DH|$D$ xH|$ xD$ uDDHHb]DHzH)/ffH|$vx{f.fAWAVIAUATIUSHH8dH%(HD$(1HHT$M>L@{HHI1H|$u7uDA$<\u,I\IM>HHH9l$t@L蘃uLLLH3{HPHvyM>I)IDžM>uIHL$(dH3 %(HH8[]A\A]A^A_f.&L-& Hp&^&HH<s~HIEHL$ Ht$HHL|$HD$ =}HHQHvD@I.zfAWAVAUATUSHxdH%(HD$h1HH|$ Ht$?H6H|$IHD$`}HI}HILnHD$`1۽ HD$HD$PHD$04fD$PAHSH9wYD$PM|MAHH|$褁At<\HSD$P\AH9vDH LHT$H4G~HHT$H4LHT$HD$(~HHT$LL$()IMHHD$ HtHHD$HHtHHL$hdH3 %(HHx[]A\A]A^A_ÐHL$H|$0LYxHILtLtHD$ HHHD$HHD$`HD$XHT$H11HD$HD$0HD$PIHD$8HD$XHD$HD$HHD$(f\LuIM)8HD$XLt$PHD$`IMu A>\xLD$0Ht$811L}HI&HD$HAHD$PHD$XHD$`N$;ID$H9HD$LD$HHt$(H)LH\HD$ILt$H\HMYH H9wH|$H4{HHD$HfI~Lt$HLH|$~tMyHD$ HL$HDHH|$LrHD$ HAAHxfDHT$PHD$`Ht$HD$XHT$H:jLrHLt$HAHD$ L HD$L( LRHD$$H|$HqHD$ HDu@AUATUSH.KA݃;vOAt*~xt C|Aĉixt .|A1E9H[]A\A]H@HHHuuiH;Asҋ_t)wt {Aĉwt {1D9|1*H[]A\A]D(St)wt _{ʼnwt K{A1A9f.1HwL UE1SE11ۃ!;wIcLfD(tHHu[][]ËWHOtm\1DGHi[:E])=]QDH1]ou[]fDWXHw WHDf.HQH9]D8:.t"=HDHHffDqHiA]t~fDHDD.E]uًQDHE1fDQDHE1fDQDHAQH AqHi][QH HqUHfDDH1wHuÐ1(fDAUATUSH/M߀;vXt8dzL DCDlt @zHBDCDlt (zHB,19H[]A\A]H@HHHuu9H;vomf.1@*H[]A\A]@(tx;@1HwL UE1SE11ۃ!;wIcLf.(tHHu[]fD[]WHOt|\1DGHi[: E@]/=@]QDH1]wu[]fDBHwWH-f.@OQH?]D.fD@:@.t @=HDHHcqHiA@]t|@HDD.E@]uQDHE1 DfDQDHE1DQDHAfQHAf.qHi@]QQH@HqUHDDHAVAUATUSHE1E1AH߀w@LHt2{(u,Mt_H{1L1Ht\8u7[L]A\A]A^9HuIHHtBu[L]A\A]A^ÐHPf.HlLt뒐HE1AVAUATUSH?toHGpHtzH=&HtHD$liHD$HXHtHvlHx}HH"jHHp&HH[]A\A]A^H1H[]A\A]A^fDH=x&Ht+UHt@(tHXHH[]A\A]A^kL%&AI,$HtILc!8Et0IIl$HnEuB|-=uJ\-?LHHiuff.f.USH?te1H Hc<+=uRH:kHxAHHhHt1(H~HtP(P(H1[]f[hH[]fHATUStW?HtOI=@kHu;t'1LH}Ht7P(P(1[]A\fHTHuʐg׸S?t"=HjHuHД1[@g[fDJ&~@Hbq~I&HI&@@Df.HI&H~fHqHI&HfD 1of.DHE1H Nf.SE1 H HdH%(HD$1MHHiHx"HHfHL$dH3 %(uH [,iff.H(E1H dH%(HD$1wMHOqHL$dH3 %(uH(hDHAH :Mf.SA H HdH%(HD$1MHH8hHx?HHeHL$dH3 %(uH [IhfAUATAUSIHHDHLDiHHy2=e8u(&t~K~fHH[]A\A]fAVAAUIATIUSLLDiHHud8uu[H]A\A]A^[if.HI&H9J&SHt4Ht/H۸tH.&HJH #&H 4&[@H5!&1HH&~ H&@H&[Ðf.H&H9&SHt4Ht/H۸tH&HJH &H &[@H5&1HH_&~ HN&@H=&[Ðf.H)&H9*&SHtHu5HH5$&HG1HH&~9H&H۸tH&HJH &H &[H&[H&H&fHH5u&H+5v&H!Hf&HS&HfDH޺+fHuHkf.Hk&t@H5&H1nkH5&]ks&H@f.Z&u@H&H1IkHR&3k&H@ &t&H]&tH&HE1ff.G G ࿀GǃGfG1ËF H F ࿀FǃFfFvjfDHXdH%(HD$H1F&tbfo&H1H&)$fo&HD$0&)D$fo&D$8)D$ \HT$HdH3%(uHXTc@g 1ff HiDf.HXdH%(HD$H1&tjfo&HH&1)$d$ HD$0&fo&)D$D$8fo&)D$ BiHL$HdH3 %(uHXDbff.G'߀0G1@f.F&H0Fh@HXdH%(HD$H1&trH+&Hfo&1HD$0&)$$$߉D$8D$fo&)D$0fo&D$)D$ UhHL$HdH3 %(u HXøa@g 1ff HhDf.HXdH%(HD$H1&tjfo*&HHK&1)$d$ HD$0=&fo &)D$D$8fo &)D$ gHL$HdH3 %(uHXD`ff.࿀GǃGfGG G 1ËH࿀FǃFfFF F ffDHXdH%(HD$H1&tbfo&H1H>&)$fo&HD$0/&)D$fo &D$8)D$ \HT$HdH3%(uHX_@AWAVAAUATIUSfHxdH%(HD$h1]&)D$ )D$0)D$@)D$Pu=&҃H\$ AHaHD$PL`J<EcHHE1LLHHcLD$A^H EHcL$bH=IH=wpAIT$tuMtpulI@E1HD$HcD$HD$fDHT$1LLD$_JctBTL)LHc[H|$LLIL9|$PLD$sfAH(LZHZH]HL$hdH3 %(DuaHx[]A\A]A^A_ÐE111LHE1bLA]x HcaH={IH=lwoIo]f.USH/HHudtHH[]+aH=HuHHT$H]H=u&Hp | HHb&H/dev/fd/H}HHEZHT$HfDCZH[]ÐSHHdH %(H$1ɀ?/t;Hƿ'[H$dH3%(9HĠ[dtRH=9H€uPioeuHpH=H=H€uHH1`V &u tD$Iu;D$u\$t]1%@|$ EؐHpH=€~HpH=uX r[fH8HT$ Ht$D$ dH%(HD$(1EZy'gXXk!Ѓ!1҃ !HL$(dH3 %(uH8ZfAVAUATUSHHPdH%(HD$H1ZHx IHHMl$ 0X/LZHrLpCfHL$HT$LLAAIĸ.fA$HI9@M9!HTAt ;.B|:HcA4$@LH HHWH@r1@uI9sy/t/HWHKHɈJu@tLHD$+QHD$H[]A\A]A^A_H=`+HILTAHI9@M9!G1E1L%/H(L[]A\A]A^A_DEH[}@/@@.K}@/t @8M9L}D$tGE]1AELLT$D$D$LT$kE]I}M9tA}/t IM9uLfDE}1AELL$L$E}HHeDI|$/tI9Ht IEAE/Lh..f0ELMA|$/D$u1A|$/@1HA|$/D$I6D$/PHxLHMIA~/0T$AFIHLEH1cRH{RHtH[]A\fDH1nEff.AUATAUSHIHsDHXL HH IHLEH1QHMxMtI$H[]A\A]f.H߉D$ DMD$ t1USHSxOH5AHHDqMHHtHH[]yQHH[]1f.fUSHnHu'H@C HH[]}8 Hk~ՍUHTfDHHH9u@f.HtkUSHH9w| HH[]ÐH?vKH9|+Hc)HHHHDDHHH9ukHH[] fHt#HHtSHHC [fDfDHtSHH?HtH[C@f.1HtHHtG u SHHtk [f.HAVAUATUSIDI$IAL$H1E1ɉrfI$H*Ht$H{EHxHH'CHAD$IAH*HD9IcD$ HANAF tH[L]A\A]A^IE1AWAVAUATIUSHHNHDg H<$F B| D$ dEIH $f1fHL<H,Ht'HH $DHxHHLBH $HIHA9J,8IcHD$ Mc1HN<H$fDIEH,HtH+DHx2HHAHIJ 8H,HH9$uDd$ IcHEf HH[L]A\A]A^A_DA|$VEID$ H $A@Ht+F E1xD$ !IƋD$ 1ɅIII1E1k1E1@AWAVAUATIUSIHHt'Ht^ u;HL[]A\A]A^A_fHtHH[]A\A]A^A_%Do DpD$ I~~CHc1L<L4fDIEH,HtHBHxHHO@HI$J 8H,HI9ul$ HcHAl$ 3fDHAWAVIAUATUSH(HHt$H$IHH_ HHt >H$Htq8tlH$xfE1/AH<$H$8H$Axt"H<$AtHT$AHT$ADD u[H(L[]A\A]A^A_fD~t~HT$VAALE1HHT$t8twfE1~Ic1HD$tDAED$fA|HcEIIH4(HD$I<>EumIH<(=CHA9G IL$*!HxDHt$H=GfDuAED$ @D$DDf.HtcG ~\AUATL%USL-HHHLE1HELLH 1ECH9E H[]A\A]fDHt;G ~4ATIUHS1fDCH9E ~HEH@HtH?Ht fD1DH6H?CDSHH?HtHH:H{Hu[ff.HcH@HcHB@HcH4@HcHTC@H?tDHH|u1f.HtVDHtSHBH[9:f@f.1HAWAVAUATUSHH/HthIID.1HI,HtcD:mLcuHL?uKH:t1HLH HH<uH9H[]A\A]A^A_H1[]A\A]A^A_fDAUATIUSHH?@HI|uzHcHSImIHtg1DH(.tHt$0H|$88uHrIHT$8HT$D$ HL;D@$Qk6fDUSHH5H|@HHc9HHtHH1w HH[]H1^2f.fSHg5H<j;'tMHP'@HHt( ɉt'@2u\'B'HfrHuع'f [@{u\'@f8[@SH4H|L%HH"t9HqA@t t Hy\HHHHuκ"f[@Hκ"f[Ðf.USFH|6HDHca"3HH@tJ@ f.Hs@13H@t%@"HQu@tHq\HH@Hʹ"f H[]fDSH3Hx1HL%\t3 HHt3tt 1HHu[sA@t¿fDAWAVIAUATIUSLHHT$HD$0dH%(HD$8173I<H|$H|4IHzMLLD2T$L L\$0AAAЅt^A< AA HMA<4tR#u]I9uXE\HiHuH|$8dH3<%(EL1HH[]A\A]A^A_fDAE\HfD~u EHHH=&7HSEHHZuHMUE\EHRHT$HD$0L1HLL$ DT$L\$H)HD$(2HL\$DT$LL$ s$Ht)HHHޤH9HuHp@HD$(HD$0I9S=:w1SH'1H|-L6%H\HHt0t)HqA@u܀ttHHHΈHu[@HDf.HtSUSHH?t#6 ubu>HH1[]fD~''@fH[]1DHHߺ[]11fHH1[]1@f.HtYtRH }H 6L1H $LL$T$AWIcHHDAAD@ACHE<vAAAABH@ADA DA DA DH|$YAHuAt{@gDEA\HKu E5A?T$,LL$ DD$(HL$Ht$@<$5D$LHt$HL$DD$(LL$ T$,CDSL'H<$HHt$HL$DD$(LL$ T$,D,HHHHAEA DADCAЃAHuDPAE1HcHH|9H9tHFdHЀvHEHH}DAHuA4E\HHnTAc@E1ABHHw6AHAAAHH{@{&AAHT$LL$H $%H $HLL$HŋT$H)^DVЃA@AGEu6DAHLUB9\AHuE\AHHvWH9@AD@tRDW@AvD^DVЃA@DAGCEeпHDPAY}@LU1ۃ@}DAHE1rHK{AHE1/HHDHHEHEHHHABHD$ME<=@:{HKDAH@AWAVAUATUSH(dH%(HD$1H?H}I%(<Hc&$'IHXfD}Et\HD$L-H$DAGvxHiH51HL$HHH>HL$D HH[]EHL AHADEHL AE1҃AtRH0HQuAfEt-HHHA[]fHH0HQuAN0t0HAH LA0LA두LcA_@0HHQt 1IH vH#wPWHHQuAtKFuCuDǃA0H XADH=널D AA!Egfff#))É؃0 A~]H0@qfDHAA--fDH>AEAf#A8HVfD DLL t#fAHHHQtHƒuAHHHQuAA#A6@HHxXI@IHLIHHHH)HH׃0HA@ufD#A2 @HLAHHHHH)HH׃0yHHA-fUSHHHtXV>vxHiH5P1HL$HHH~HL$D _HH[]EHL AHADEHL AE1҃AtRH0HQuAfEt-HHHA[]fHH0HQuAN0t0HAH LA0LA두LcA_@0HHQt 1IH vH#wPWHHQuAtKFuCuDǃA0H XADH=널D AA!Egfff#))É؃0 A~]H0@qfDHAA--fDH>AEAf#A8HVfD DLL t#fAHHHQtHƒuAHHHQuAA#A6@HHxXI@IHLIHHHH)HH׃0HA@ufD#A2 @HLAHHHHH)HH׃0yHHA-fATUASHdH%(H$1Hx.HHDxHމ-Hu1 @H$dH3 %(u HĐ[]A\7AWAVAAUAT@US@1HHt$Ld$dH%(H$1ISfHcHcHH9|")LH$HcH$II|LLDLDFHIuC9|)LHcIHcADHD$HtJL(H$dH3 %(uIEMHD$'E1HD$Ht$|$mHEIUH9w@HHH9I<$HHT$HIHT$I$HUD$'A]C/D$'I;D$t+EDpHt$|$責uMt ~HcACHHt$(dH34%(u^H8[]A\A]A^A_DTfDH:HDHEHtI$DH]H?HՁA<.yqHE1 v<.t*HЀ 0K HHLHu҄<.1E1҄Lct4DXA  0OHHHNPLcلuHJcLHt McMLHtLfDE1H<-AHGL t GHE1fHt McMLHtHAE1DHt McMLHtH1f.GHG5<I3E1Ht McMLHtL1f.fHXdH%(HD$H1HT$ 1HD$HH$HD$HD$x H|$8HT$0uHL$HdH3 %(u HXÐHEDH(11dH%(HD$1I1H$1HD$HT$dH3%(uH(DAWAVAUATUSHdH%(H$1HHt$t?IuJ耿HD$H$dH3%(HD$HĘ[]A\A]A^A_f.T$HD$`HÉD$(|D$8HcT$HD$Ѐ%ۉT$D$</HD$h1Ll$1E1AHD$@HD$\HD$HHD$`HD$0fHcHl$HDet.DH5NDrH|$uP9*DDd$XMcAEELd$H|$t=&D{~(UH5 D<H|$DDD$,RH|$ HHD$ T_HL$ AH ADD$,|$tN|$|$@|$D$A|$8D|$XEft$<LE|$8KD|$XAHADQfDAE<$=&UH5ȼ D;\$(.IcHD$ffDL$<Y|$8D|$XAHADQ_A=M HMcF<9T$(HL$01HLd$`)Hc HsHED@Ld$`3\|$8AAAAT$(HL$0H|$XHDL$ )Hc$ HPDL$ HHHAD$X>E1AD!ifADH= DHL$pHT$0DHHL$ IHcHL$ ~DpHLE~ fD}D|$XA>At A DnD3^~DNAnfDT$(HL$01HDD$ Lt$`)Hc HDD$ sHKBDLt$`7fDHL$@H|$H)HcHH HHDd$\f.T$<8|$8iD|$XAAD|$X$A8L@E?f.EAKA=6HMcF<"f.EK~fDefDAD$<EAAhfDHL)HcHAD E|$8D|$XA@E1DE-D5ADE1Af.E1ɅAA@AtA u|E1D Dt:ADAtA tDxAQfDDL$AE1aHD$AVAUATUSH dH%(H$1Ld$HLHL$HLHLcL LHH l{1ILLH ĐH$HD$ H$dH34%(uH []A\A]A^D@Hff.Hf.fHr&tH=sr&Ht H]r&_r&Qr&Hff.Hv'HHHw/@~f@>fDHF@~HHHVDf.AHAv1H MHH1S HfH H1&fD1xmHF?ȀF?ȀF ?ȀF?π?@~ȀFf@>HÉ?Hπ@~FfDHF ?ȀF?π?@~ȀF@H F?π?@~ȀFHF?ȀF ?ȀF?π?@~ȀFv 1v 1fff>1HffDH1҉f f$f-(f~fFfATUHSHHPdH%(HD$H1Hw1H t"HL$HdH3 %("HP[]A\Dn&n&1HHwuH=n&HtLd$ E1111HL$$HD$Hl$HD$H=n&HT$Ht$LD$H|HH$LH0$D);DH=SftOHI8.H"HHpH=m&'H=m&@m&Ht=m&UH5m&H=sudHHm&m&:{DHH1dfD>m&ASCI=7m&UIf/m&~H5H=m& HH/m&t5/m&)m&ArL1HH2HPHvD9uH1HL$dH3 %(u H[]A\A]A^@AWAVE1AUATLcUSAHMHHT$@LHD:~)Å~#HLcHDu.AA~D|$A)HD[]A\A]A^A_f.{8tAf.@HHh&t H@Huh& H%hh&HHPHUh&H%Hh&HAWAVAUATUSHL=H%H=%H=VLL5gH=DLL-H=2LL%H= LlH-UH=HVH5OH=CH=L4H=L%H=ުLH=ӪLH=ȪHH5H=H%H[]A\A]A^A_Df.SHH=f&HtKHtFH^HxeHH Hf&HHIk&$[f&1f.Hf&1Hf.Hf&Hc,&SH&Hkf&H&Huf&HH"f&HtЋ5%tq +f&H=f&uH,H9+&txHt e&u)+&He&HtЋrk&u[@SՐ[=Yk&V@i,{@裗UfDHtye&uH5 &HH"H=&VH辩cfj&ATUSgHtwH=r&H-Ue&HHx蜨HHA1HqL%#e&1҉L HH=e&HH9d&u[H=1r&tbl1u]Hd&HHxHH[]A\fDc&t=i& U[1]A\fHD %EuH %H9%&t';&)& hh&軭D0&Euo)&=kc&Ah&t5 &tHH9c&t HfD &u &uHH,ZfDc&u@Hb&&&&HLc&Hb&H:c&ÐH0肦Hb&HH@@(*HP Hff.f.H=Ib&Ht,HHG H5b&H=)b&HuHfDGAVAAUATIUSw D%Eulfb&HcHL<"<E1/%uH%H9%u [D]A\A]A^Da&NHca& Ia&HJa&r9|"HHc ,a&臥Hcxa&H!a&J@ ba&I$[]A\A]A^!)p@E1H{+Hc#a&H`&H[HHx諤HHPHHsE1h[D]A\A]A^@LkMkL;-4%nHc`& Q`&L%:&-4&HE`&r9rJ `&@,Hct`&H`&='%=%H `& &AՋ=)`&AH%n`&&uHCH;%tHD`&e&=e&PfDH{5%ƒtH%I9Hc_& [_&H\_&r9!J _&@, >&HCL-_&H&At#I$[L]A\A]A^bf%~ AiEu1I$H5&[DL]A\A]A^DAtA AAEHV&h L`HHP҉PH ^& H@^&HHc ^&tHce^&H^&I$H^&QkAPH9&B|3%5%@H&h L`HP4fKsHT&Hui=P%s^.fE jAfD>lf[H@@DXt 4H&&-&)W&f.H=%OH!&HT&MDH&HT&%DHi&HjW&DH%H="1fDH=G]HH2T& DS&ܗHS&= T&Stu1H&Ht=S&= t&u<@a&tHHP&Ht?H[ln1H&5&G&GH6S&HG$S&G H`&HGH_S&HG H|S&G(&G,H %HG0HVS&HG8%G@%GDHR&HGHR&GPHS&HGXH S&HG`R&GTH`&HGh&Gp&GtHU&HGxHU&HHHU&HHzU&HH\U&H1øff.H&G&GŴ&HGHR&HR&G Q&HGH_&HG H$R&HcG(HAR&G,&HG0H%HG8HR&G@%GD%HGHH}Q&GPQ&HGXHQ&HG`HQ&GTQ&HGhHJ_&Gp&Gt&HGxHuT&HH_T&HH T&HH;T&HHT&1ø@USH\t]@H=IR&)uH[]\fUSHcމHR&H R&92ߍs ;)H)Ɖ5Q&Hc輔HHQ&HcH5hP&SHHcDH[]@f.HH P&@OkaH%P&w &HP&H 1HfD軁HÐHE`&T&fHH 4P&@jH%'P&`tBaw"HsP&Ht[&1H@CHf"&,&1Hf.H_&#T&ffDUS$Hޱ&H(H@HH X@ Pװ&PH[]Ðư&9&|SH&t La&ts&[f膏9ÉV&ur&[G&@f.H5.&H=_N&&Hf.HHv `&t-&HHfHttcO&~ H\O&fDGw )ƉǃfDAUATUSH.O&~lAA1f.O&A9tBt^-P&Vt-N&9-:&uDA9܋N&uDu N&u"H1[]A\A]D~N&+Y6VN&H1[]A\A]Df.xHcHH%8t1$0 wm?M&u;%+M&DH H9Hu%%fD~%L&Ph%fDSc1[f.SHH=M&hcM&~A;H%L&H]M&[5L&HY\&P&Zf.H%@L&[@f.SH3M&t~ M&H1[fDt$ M&=Wt$ AUATUSHH7tct.H=1AH%K&H[]A\A]w H=qH=Э&5&LJ1w H=AHV5&=&1JVSCu&mo DgH=HztjWtD;%1&~D%(&-B&HK&Ht 8}=&5&蜈H=K&Ht ??1[HLcBDhtXHB'Hv Z&tH[]fDHH[]efHH&HPhDHH9uH%fH&D%i%%(I&=%5ؼ%μ%f.Hɼ%=%5%%=H&H%DG&ufDt*H=eHHHf.@f.t*H=<HhHHf.@f.5RG&ATUSu%%޻%%=ڻ%&iRt:IHG&Ht 8H5%[M&]A\ÐHG&Ht؀8tHǍkAQt'5&H=G&AT4օuR Ψ&<1[]ܨ&A\ÐHQG&Hd8[&~1DI詉d&1@au HF&H8딃AHF&H8AJ^DRf.HE&u1$K1H1J1HSHME&t1|$ 4 &|$ )~&މ荧H1[D1IH1[Ð117H1[Df.HNtnu61HfDNv61HDf./St0?tu1[f.k߾?51[S߾/51[S17ȸ%%%D&Ը%Hݸ%H%pC&t1[D u&LC&EY8&A9USDHcA9A A À @@tDt@BIrH fDEt*&LD9AH @ŀ @uр @ƀ @t>Et9BIrH E9}"&TAH  uكtd&A931[]1Ðf.LwB&ttD2&҉~cHcA 0 tt toAD0< tP< tLHcILf.1H@ t@ tBؤ&yމФ&u1fDB&tHcA  t u-H@‰&tA H t thn&]D &H A&EQt~f.B&A9~iHc< t < t %&D9}EHc< t< uIBD)HH@H9A&tH t tEuu1ft@5&A9~u#t$ |$yHcT$ H|$DQHu+1Hn1H@ @cӐx\H&;&~7u#t$ |$HcT$ H|$DQHu,1HKn1H@)ff}AWAVAUATUSHD5/&&EfD9GL-&<&E1D$ HcAD< < &A9HcAl@ t@ u3CD)HHH9É&tkAlH@ t@ tH0@F@_tyHc#A|~u$@_tH@ t@ tD9É&|ѐD9|$  &t AD9H1[]A\A]A^A_f&DHcf.D9É&}A|H~u@_t1HxHu#t$ |$HcT$ H|$DQHu 81HÐ1H@;lHÐ2&;P&S}EH5X:&Hc t2 t-T t tEY&&*tm=tx\t12p1[fD i% %% ;&%H%Hή%9&t1[*~i@?ni1[f.Ss}e%%%:&q%Hz%HS% 9&t1[SH%D%6%D:&&%H/%H%8&t91[DS|޿1[ H٭%59&H%f8&u 1H1Hb%5%~%59&n%Hw%HP% 8&u1Hw1HH 9&uRH=E&=9&Ht0ƒ׃Au& CE&H@CufC=8&R*9&H{E&tH8HDHtxt8&~H8&떋8&~='&pH)ǃ@f.H&~ yHq%H*%7&@t$6&tMH b7&@1H>Ր0u =Ы%t 齔D:7&uz@ATUSAtO5a&;5&|aEA\$tq2ux[1]A\fHHcDQu5&;5&}H=)6&ܘ&fҘ&t;&t1HHv wH&t-&1HÐ[f9=&|1=u&@Hy1HAWAVAUATUSHHcFHw5&]&/&D=L&D9~ D=&DD5&A91DID9WA9A9tA}ct8A9} D5ė&&a5&t%HL[]A\A]A^A_aA9D92WtA9WH 4&Hc< < hAA9KHt4&Hc< 5< -&G@<$$HDPHH$T$}H$Ht$/&YfHt$D3ATUSAHdH%(HD$1KHH!/&3&AE&7&tC/&cE HAÅH=.&rH.&%fDHq.&H HY.&HT$dH3%(H[]A\f. HIcDQUE $HÅjK_Zf&DE c&`qH= .&H%-&fHt$D7ATUSAHdH%(HD$1HH-&&AE&&tC%.&yE HÅH=P-&KqH@-&%fDH,&H H,&HT$dH3%(H[]A\f.HIcDQUE $H+Åj]Z&DE y&oH=,&H%>,&YfHt$D3USHt&tT?H==&v >&tQ;9L&NE&1ۉ0+&~ ;,&um \H[]DH=+&=ō&AVAUATUSH0dH%(HD$(1&9&|&1HL$(dH3 %(]H0[]A\A]A^YHv!=&E1DmtD--&D;-J&}HU*&IcH9uHhtSnHD$Et\5DpҌ&D9} Č&Ds5mW2HD$Eu1lBDHl$5m&H=)&HD$Ld$Ll$HC)qD$HLD5&{xHD41&A9~ &Lcg58Hc5&݊&9#)H5(&HHcLHsLHtgDt$D:D?*tDD$31kxHcA&Hr(&D4Dt$fDD$E1^@f.ATD%&USEtd~ڼHv :&tZżH=Ê&v :&t_)߉=&y &1D'[1]A\{Y[]A\Ð߉7j=i&H='& lj=&AUATIUSAH@DpDtL-&;-&}>&9} މ&ѻHv9&uLIe{i2H1[]A\A]fATUISH HHdH%(HD$1'&xXH6&n+&E$$t8t362HD1HL$dH3 %(uH []A\fDLff.AWAVAUATUSH&D$ 8L= &&Dl$ ADOAAzE~IcIlI@ A@ A ƄE|HXuKEMAD-Z&E~IcIlI@ A@ A ƀ  HYu{EiAuHcƉHH)/fIT  HQH9Aʼn&u t AuHcމLsI)A݉&HI9I,@ t@ tHhuAD-H&AfD|$ DD$H1[]A\A]A^A_HPDAuHcƉHH) HH9Aʼnن&yIHP t݀ tIl@ A@ A 'Uj@f.Hgt& &9}GH5#&Hc< t< u1B)HHH9ȉ7&tH t t1H@f;ATAUStj,teTftu#&#&-ޅ& ($&5#&[DH'$&]A\?y5z#&t #&t؃;E5`#&f[]A\@-r&<#&.#&"&u}H=#&>#&5"&Wf"&"&F "&"&fDDF"&XH(2&PHH +"&[H2&]A\ýAWAVAUATUSHHcS&H!&I<[<{<}<] H- &v 3&H*!&Hc<[U<{7<}Q<]I&98޿ d-&AAAA@kHt 33&t{AEH &Ic<[~6<{<}<]uD=&1H[]A\A]A^A_f<(<)Du19sH= &1DAWD9DAEkQH[]A\A]A^A_<(<)vfDDD9DfefDftfDAAA@ Ht1&AD9=&-H&Ic<[<{<}<]t19Duuu1<{<}<]޿a`&9fDH&Hc<[uAfD<(tl<)DtV@H=A&D1ɺAf."fDfDDfDkA^f<(t<)D=u&hOMA&<(t<)t@[tS~){t}t ]t-1f(t)uf.fDfUSH(&dH%(HD$1tN4&D$$x|twtr(H1_HL$dH3 %(uRH([]@&uHÉ&DAH,&HH,&@t@B&Su1S@Ǎ|c3߾c[@H=&SLP%&tR%.% %L%'& %&t*HK&&[HՐ%1fH ܐ%H%&LA@<uI<H<HHuHHH H HH9u= %HeH H5HHHHH5kH95А%HfDk&tHH=+&H>+&1;&tHpH +&H+&1Hc!&ATUSH5&HHz}&J9|&@Hlj5&HcH^Hc&HM}&L$'^Hc &H1}&I$H4Hȃ&H.H^HD[]A\ATH5 H={^UE1SH-c^HF%HCH3HHH2AHu[D%|&;&]A\.&u@@f.ATUSH&Hk|&H:t]E111,H H H HHH<HMt*HA9AHIcH[]H |&f11H 5HHǺHD$HD$H[]A\f\fDH\HHHBHH9uHSH1D  HLHLHHu[HH fHHfH HH9uHhHHHHHf.H HH9uHDf.Ht USHH_HD<uH;\\HH9t"C<uH;HH{6\H9uH[]f.HSHtH[ \fAUATUSH~HAa}Ag}tcH &;^tCHDxH%k&uD.}H[]A\A]Ð }H{DD뺻fUSH|5ey&C&9&H>&5.&t<&H-&9}HHu1Hc"y&H5S&螨y&HcDH[]vDE^H}fDH5&HcLZHH&HtfHw&1U5Uӊ%t+H='&HttH'&Hf.fUSHH?2&~tZ&{= &{{HË8%uXH;8w&w&w&]H[]ÐtFw&FH1[]fD{Df.USHHG4H=u&_w&iw&u%Htd3sdH=Q&H[]fDC8H,&tH-^&H&Hx-XHHҦH&FEʽH%&H[]AUATAUSE1H9t!&5&H=u&DDztOk&y=`&y(zIyH=O&I,$Ht E8H-0&uMI<$t&usHT&H5&HU+u&Ht &H) u&u&H1[]A\A]@=&%HXn&t&u&@rDp&u&t&fu&H[]A\A]@f.t\USHHH&H9tHH9t1&t*1؅@H1Ít6[]) 1DH[]uftdUSHHH\&H9tHH9t )&t/1؅@H1Ít6[])D1DH[]qtt\USHHH&H9tHH9t1&t*1؅@H1Ít6[]) 1DH[]sftdUSHHH\&H9tHH9t )&t/1؅@H1Ít6[])D1DH[]atSH H~5tpu}^%H[DtstStit$ Ht$ v"&Y@ur&tW_tfAoC0r&C4gr&JH%&H[@ NH1[H{pM f.ATUAS1;AHuHC8DcdC`ooH(&H&:q&Dp&腺H=%HH1!HSHB&H[&HЀH.&1tVfHxRt H舐u1Hx41H*1H%&H&[]A\[]A\fDS11H%&H&[fD?Ef./E{f.HH=&Ht &H[?HÐHH=M&Ht H?HÐUSHH2H߉tH[]1HVx1H趎H%k &1Hx&H[]ÐUSTHdH%(HD$1HHuHTHD$dH3%(uH[]虡fUSHH諞8u&HھxH1[]@H[]@@t@HH>tHH:ttEtEIIA8tN%u$t>HHπ?u/HHGDtHHπ?u H HGHYUI@HHB|H \HFYUSHH 蛝8u&Hމ輦x1C u H[]H[]fH=W1c H[]f &u@SH=C &H5 &uJDn&ugH= &H5 &&xH% &P &[f.H &H=Vsm&t1B=H=%j@ &t HH8ty &t HH8tR &t HH8t+ &tHH8u H-XHPHXHPH XHPHWHPwAUATUSHXDO &dH%(HD$H1Et"HD$HdH3%(HX[]A\A]AH= &H蜡IÉPkLIfo$HD$0D}%)h &EfoD$H &D$8)] &foD$ y &H: &)S &t)HD }%EhHD  & &H 5 & &E= &H&D  &D & && &@= &@5 &5&D &D & & & & &D &D & &z &D &D _ & &\ &D | &D L &w &D h &t6=|%t$T$L$DD$ }H=|%Q= & &%C &D$ &@t=>|%t$$00ttσL$ $fL$t %D$ LD$ zx\pj&&H=3&t%HH=^SģH=&H &Z &AEu_u&H=%@>9afHH=@{%H&D{%H={%=&~H={%HM&Dz%9ܚff. &=&HH=&贡1Hf.HH=&Н1臡1HUSHHXH=&dH%(HD$H1蛝ÉRmHxDD$ L$HT$t$HD$HdH3%(uHX[]1yf;&tf@f.Sy&t 1ۉ[H=&H5&fo&H&H=&)I&%N&%8&fo&HY&&),&fot&F&)'&rH5&x&[fH=I&D[H5 &U(f.&u@HH=&H5&u T&Hf.DATUISH1Hx8GHHN&HH{͕MtH1&A$H[]A\fUSHHHdH%(H$1H=>&HD$t.趗HxFHHbH|$HD$ &Ht$HT$1蜗tqT$(/@tP %tC`#t6@t)=t|tt71DH|$FH$dH3 %(u)Hĸ[]HÝu*HHHdH%(H$1v1҅uD$1%=@H$dH3 %(uHĨ蛖f.ATUASHdH%(H$1tFHcd&D &EH 0&D9$ft\Hc@ڃ5&HcƄuwb&9c&%H$dH3 %(Hİ[]A\Du&Eur%tHc҈ڃf1if蛶H=&Ht9H&Hx-DHHҒH|$HD$z&HDHl$EHT$Ht c&tI贘uD$(%=@tp=a&9b&t?HDf.諔fH$=fDH$=fj%tHc 7b&H5h%t8u4|/zH==iHHKT/H(S/H”Ht98t4xu:H9t)HP@H9r6fDHH9t$.D؉eH5F%WH58%1GHD$DsH|$8>EHL$dH3 %(DoH([]A\A]A^A_fHDHD=#%AEtD5%ED%ED%E낐H(=b%HD$D=ξ%EHAHD$E "%HA/P=H5%DA A؉HD$put*I>Ht$(Lїڍ\NE9$9NIL9t$$`H|$HTHD$H81$,=%HT$0H5%E1t5H%Ht) K&t%t5K&H|$HHD$HILt$0Hct$$H I~H{H|$Hd}4$9ADMAL$$Hl$McLLd$H@H9l$$KILLAHzuHD$0Hl$HL$$H8HmzD9|$$MtLyHD$0H(@HL$`Ht$h1HL$Ht$RE`IFF<(AD9teEEg|Hv D .%EtmE9%ILcF$(AD9uHADht蝅HD$@蛅HADhtxHD{HxE*HL$0HHHxfHL$xdH3 %(D$$u|HĈ[]A\A]A^A_f.Ht$0HHHv\xL$$Hl$HD$0HHpH8:xHc,$}Hc$zf.AWAVAUATUSH(L?dH%(HD$1t$M5X%IHJ%HD$IZDHI|uLI/HIOIGHu =DHVHxu9}$IIGHvM<$HL$dH3 %(H([]A\A]A^A_@IHt.I1HDHJHxu B%JH2yHx9(HHvIwHD$H\M1Ll$IIvHt(I.Hu{uHI(MnIvHu؍{HcH'IWHH IOHcHL9Htt HHtHHQHuHI?L9tC(H|$H}t%LI*(HS%H DH]HzuH'HEfDLtI$1ZH IHcuI@HL%fDLl$H@I?L9tk'HD$HE(wUSHHH~H=%Htr d%thJ%t^2@tHT$wHHT$t@H5A%HT$Ht/H|Ht"H#%HtHT$HH[]@HH[]fDAVAUATUSHIHD1BHHIv t'D8tR5tD&ɍVt% uC&9MAE H5m%Hc8>5EL)HI| D H:LuHH9u9} ;tH Huʼn-C&M9t[L]A\A]A^%f[]A\A]A^L @L%HcA: 8HA:LDDH%Hc:L2tHD8D8t2E8ufHcHV%L9:+A:MwLL @USHHH?HtH]H$H{HuHH[]$t fHtHH%H%DAWAVIAUATE1USE1H(dH%(HD$1Hl$Ld$ :tXHD$fDIcLHLD)HcRtHHtSAŋ%|$ t ov?Z%}gGv_wAVIcAƅDHL{fHL$dH3 %(DuZH([]A\A]A^A_fDA|_~GwA%DAAAAHE^s@f.H9=%t'%!u=%Ƀ@ N%?uDf.@&@&Ðf.AWAVIAUATUSH(H%-z@&H|$H4HHD$$H=%0n1E1E1E1EH`%Icǀ'\H=8%T$rHt'T$AG?&'"AqHv%AA9jD%?&A9u|H %IcHu}HD$HtD(MtAH([]A\A]A^A_E1x8h-*?&1[H=Q%D1ɺAWf.H%HET$DHЅT$H|$SqT$HH=ߡ%E1Ht!։T$,qHT$t +->&DMH=%HtqHDX>&DA"rfH|$։T$pHT$m1@E1pHH 5%5=&v%%uH1詎H %A DDfIcD%=&HEH|$HL$։T$6pHtH%T$HEHL$DHЅZHc`=&H %1IH@AAqH=h%Hq%HD$D%=&D9H ?%Ic1E1H{A'f.1E1,H|$։T$QoT$1ۅ,1fAWAVIAUATAUSHHD%)%4$EX-%HHH߉VnD$ A9|"D9l$ =%M%9D$ 5%;=&~:H=AHt8t1 Hp<&9L؉AA$T$8D$t;@A9E9<&D$~xD\$E$D$D$8D%EuD i%E-+ D;&EM~E1MDl$LEDd$ M@֙ %At;&D9t@HI4H%HtH4$H4$HD %t%I|tT$oZ9L$ H5%H lI4HwHH[]A\A]A^A_ HcD$8s|$HD$HD$$HD$(D$ D$?HHD$0fL$ 9 $|$?HD$(I,H\$ HD$(E1\$8HD$0HcHD$f5%HtHNjT$ HAD;d$}IA9DE1)H5% AkA9u9$|H\$HD$LH,Hu0%t &%uV %D$$|$$t$9&9L$ 9L$8~ D$$xD$ Hl$0D$ HD$(9D$8HH[]A\A]A^A_/HHkHIPHLyjD$ H5% jf.l$E1)H5% AjA9u9%%%HD$ H/HHjHH HbHAD$ H}}D$ }D$ iD$ fDD@A}H=9Ht 8O88&hHHc4$H I~:gA)HAu;E9D9l$ L$$DD$8QHUAĀ;D$ t{D$ t{D$ tHATI=%US1vI|$HtMDz%tyH9ʼnLHI|HuH%^HtUL[]A\2%I$t H*HI4$1Hdzq%[]A\%~^9|ZH=F%Hپ1oH=*% l8%u$1uTq%Lpu%pHtVDAWAVIAUATXUSI1A H*HH@hDHAI9H%=%A 1۽XH-HHt_HcL=+&1%D$%=%o=%5*&D %DD$H%5%HH%HH%S5%H=%9H=%H%%}%H?fDHH|uQ%t%tH=A%Hx *%j%Dؙ҉%u =%xHcҋ5%H %H<׺Hc%H%H=%HH9^%5%HB%H|$H5x%=a)&c%5e%i;H=\%HtXH=S%H@%HtWH%%H(%r%1H\$dH3%(H[]ÐH-9%HHHDfDxH=%HtrWH%%z[5a%H=~%H W%}ZATUHSHdH%(HD$1H%H9HXH9H=%HtVH=%HtH-.%%H e%@%%H%H%%%%%i%c%a% '&%=9'&1 %D$%=%H=%5'&7D %DD$H%5%HH% HH%\H0H=%M[5%H=%j%=H=q%Ht_UH=h%HU%HtCUH%%H=%%1HL$dH3 %(pH[]A\@ %H=%d %V%ؙׅ=%u =%ZH%Hc5%H %H;%2 H=%HtQH%%fD% %5%H}|%zTifUSHHukH=%HtbQE~%H%H[THxbHHRHH%8T%VDsWHHi%tHch%HtH=j%8uHQuHSHxHEHc=,%H%HH0|Q=%~u %HH[]CX1HH[]AVAUATUS|Htdt?zAݸ\C@A@fEE-ALe9Qf\C-?@H[]A\A]A^f.\e@fH[]A\A]A^Iĺ1KHwFA$\2ʍF0HcT5Y0HcHHDH[]A\A]A^D\u A$\@"tL@[L0MCnu2[HIB+LDNHB9t NHBADFtH[H`NHF,IfS1Ht?uQ%1[f1 TI1+%[DHdt?u%1H 1PTH‰T%1HfHt?u3%1H 1T%1HS1Ht?u0%1[f1 SI10%[DHHt?H8u)1HfD1HǺ ySy>*@ǐSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H=% H %HD$HD$ $D$0HD$W%t(D]%H ^%HUH=%1WH=%HHھLH5~% TQH=m%SHD$dH3%(u H[jOf.ξ%t&HǾ%%H%1H=7H1~1HHStz?tuH5(HKtrH5oHKt_H5HKt97HcIL1fMAD$HAl@?t@@9 ADIcLfDHT$LL$ALD$@<$TR<$HT$IcLD$LL$AH(1AL5ADBDU EDaDAAWADHAt$0HcAL y@At$DHcAL y@DAIcDLADIcLADIcLADIcLA DIcLA DIcLA DIcLkA DIcLSA DIcL;A\DIcL#ADIcL AIcLA@;DIcLEbɃAA0EFiIc@;DLDHT$ LL$LD$t$H $,PHH $H|$(t$LD$LL$DxHT$  CH|$(HH $t$LD$LL$HT$  b&%AD$tH z&%t-HA|\AD$HADȀH1JADIcLHT$LL$L$\OH@L$HL$LL$HT$DHBBHL$HL$LL$HT$AEA|CVA|-JAD$HAl@?t@@9t$ȀADIcLAHT$LL$L$NH@L$HL$LL$HT$DHt|AHL$HL$LL$HT$Ȁ느f.AWAVIAUATAUSH8dH%(HD$(1Ht>Hu?AAHT$(dH3%(DH8[]A\A]A^A_fHHL$DL$>DH|DHT$$HHH$AL$D$$1DL$HL$A\({w"#%tu HDHcAHH9;@@<$t/HsLD$Ht$<$HCLD$D$$Ht$AHHKt&EuiH;5:$tHD1HA9H z&WH l"%wG9"%t=u$HHHHp1@HT$dH3%(upHHcHHȀ8tHpH &11҃\uD$\@|DHD$H1HH !%AUSHHHtHHݑH1[]@SHx!%Hq!%He!%[SHX!%H5Q!%1HC!%[Ð1fHHH1 @f.AUATIUSHHIHdH%(HD$1@H|HT$HHH(u4LHLHL$dH3 %(uH[]A\A]fH#|@ff.SHH=}&H;u/Ht<M&HJ&1[HtHxHH0tM1bI뎃HT$HcLHI3HT$HBH $A\A eAOH$I1ҸSH5CH2u,%HtHH=HE[@H5^HQ2uH6&HB[HHDfDH5H!2Df%H5SH2H5H1De%H5H1H5H1WH5H1HY%H"1HHHH=ˣ%H1HH%ǣ%[fDD%H H=% =Hu%[%HAkH=H=[HD@H5H0H %H{T%H9?H+$H4@HH;J,HBHu%Hj HH,[HDD3 EZ&H H=% A1H$1Hf.HHsHL+AuHcH$MHDmLtt4E}Et*H5L{+tA1uE1A}A AHDmE&H@uH1[]A\A]A^A_HH5H+H5H+_%1 %H$1H5{fDHHsHtPL*uHcHµ$HTmHDHGHL[]A\A]A^A_=>%a$@H= L1 fH5HA*4Df.AWAVAUATUSH(dH%(HD$1HA/H@ t @ u H+@ t@ t@@#@$ =%@"I1E1DEtmA:.A $A UIcHD,f.A:A HA D8HAH)IEDuE1D$ H5ˡH(Aa@@ t@ u.IcHD(AI@H@ t@ t@'t @":AIcHtT\|@8AIcH t.HL \Q@8AHHuD$ qEN;"-HL=h$+L`HH5gLD1DHHHI4HFL'uHcHAlL5$H5mII6HHHHtHAL=7$H5,fDII7HHHt@̀A]'t6"t1H5(L'ALE1HBL)@l$D$tHID8uH %IuH|$fDE1H|$dH3<%(DH([]A\A]A^A_@@ t@ u#f.IAE}< t< tLf@ n@ dHkHC@uHL%Z$H5pfIIt$HL%uH(HDH9sfDHH9r  t tHPH9w xt@HLKH{ t HS1 HH t tHcЄIHTu"-H   pIԄu1H5iL=$!fHHHI4HiHLc$AuILCT/ SA҉t?\tV"AIc ҉t \At4"rT H҉uH=H1AAD$H<tAIc҉uA:u |=3@AAEMcIAmD$ A AT$HcHڀ:AQLL1hH@@ t@ @H+@w@ t@ tfH=YH1E1A$HL$A$0 t "HDIĄH t tL%P$H5IIt$HGL"u@"KLKLȅɉtS\S@"tDHcH;0t1LD;Hǃ\H&"tA0LHIuL@tAMcJ#< JD#fH HuAIcL,Am{@AD$DAMcHD$ IAmH=cH1A;EvI9mH=HAA,$E1 H1BHH؀8HcHɉ}fMcIAmD$ H$HxHCt?H1"@u#<"t,Hc1D HHtR<\HuHcHA]L't3"t.PH %HH1HE1QHb#tHID8uH%IuHmH t%Ht$H3%@l$D$Tz,HLcBDpHB,A#AEAf.AWAVAAUATUSHHH=j%5`%dH%(H$1CHHƿHQ& 11H8)ALl$0II}ELHDID$DI,E%McHMAE%aMEM9%x%LL91ۀ} HEHufDHx tI9HuLEt4< t < uDHEt< t< tt <#tH1Hcۃ%HlL9qLߐ%1H$dH3 %(HĨ[]A\A]A^A_@H=%H9HtH HxHHbHk%fDH1fD=%|=z%|^HH0Z%uE9=H%|H*HLsH9 fHHt7?uH=#1H=t1HfD1HÐH=y%HuH=xHHt@f.H1$tuH $H $HH5)@%H5$Hf.=5%ugAUAT USHHL-֎%D%ǎ%H-%tuH)L-%D%%-%H[]A\A]f.1f.AUATH5VUSI1H-7$HHHHHtHt+LLcuIJD-H[]A\A]H1[]A\A]HHt Hf$1҉Hf.H>%H9t,H$HfDHH9ztHBHuH/UDf.HtH=$fH$$tuH$H$ÐHY>%H$Ð$HTtH>HHEATUSnHtRHIHt2HXH-@H=%1HHN%HKHu[L]A\f[]A\Ðf.AWAVE1AUATIUSE1HXH|$D$D$#f<`XIILEHA<uItHtH|$HHHD$tH8HDHcl$Lt$ @Dd$+Ld$HH D$,HL$8H HL$0HHA(M$/HHI/H;H HxH|$IAA,A\A"D$+AD$A$H3LAM#H;ED;t$jD$ LHct$HIL@HD$I9D1DHŋD$X;\$Lcl$I\$IK,KDdHXL[]A\A]A^A_ÐD$+A$\AD$AD$:fDLd$Dt$Lt$ H|$wfEA@D9D$,tBH HL1$D$ LHct$HI8fDD$@#HHD$8DD$@HT$Hut#HHD$0DHL$0HHT$HHctqHL$0HDNDBt4#HHT$@GHL$0HHT$@H뗋$tHD$ t$\eAD$fA$\C-?@A$\M-H5$t@AWAVAAUATUSHjH5%Hÿ HD$H+HLkL5ef.HH5!$H EItyHhHHHt3DH=9%IL1H H{rH HuLbIImHuH|$H[]A\A]A^A_=DHH=փ%HH1 I $HtI\$ID$0HH$H}HLH=%HCLD17 HMHt'HH9,$uH U%H=lI<$H f.HwH{HufH1H=%HH1@f.H.%tH %H=׃E=%1H@f.H5$11PH%tH C%H=wH5$=@%11*1HAWAVH$AUATL5USH$H L-HL%L=5DH=%H1nMt;HSHLHI֋MMDŅuH=z%1L3MuL-G$HL%L5x&Hd1Ht@IEIIHLHIt݅H= %Lu1LHuH[]A\A]A^A_fHN%tH À%H=e=ǀ%1Hf.@AUATIUSAHHt ?@1AH(HADb Hi-search@ H)`IcfHHMtL>B|%HcH': H=eH1&H4H[]A\A]%E%@;x@HcSfDHreverse-@HHcHZfHfailed HC'ATUASHD hH@H@H@H@ H@(%C0u%C4C8CI I@HAAHtI68;T$Ll$AEg`uE9g(tDt$AEweAGi%H+i%t H[ i% i%]A\@f.HH=c%`c%HDH)%HHtH@Dh%>h%h%"h%HtHxh%1fH=qc%ATUSx1VHgh%H@)%HHDEc%H8HH)%HH8pH-!c% HHHHDHIĉpHv8u%D%mg%(%1ۅH%AGg%tiH(%g%HpH11Dg%؃H9}HcH4Hmb%D&Tg%[Hf%1]A\f.H=qxDD1H6f%6H'%'g%HpY|HH'%HHt%8tH@8uHHtHB.f%(f%f% f%HtHbf%f%A'%1HfAWAVIAUATUSHIe%'D=f%E?e%Au9uH[]A\A]A^A_A6D 3s%E&D-e%A9}1H5e%Ht%IcLDL$L$dL$DL$1LDL$L$DL$L$AAH P&%e%HAEL9s Hc5ye%HIHcLLH)HI9DB΅tee%9|NAD9|F %9 d%|EHcd%;d%u6 d%DD9ND9|"H5%%Hv+)9}E)e%A95r%Fd%EHH=%L$E1HL$d%E9Aq%H=`%HH fDH=A%HھAE9ufDE1;c%D=c%D+=c%fDZ%9c%D=c%f.9AD)EAED)9 $%9%f^D-b%H[]A\A]A^A_A9}IcăIIDD)HfD;H5.^%H=H9ufDDD)ՎH5c%HcLDL$L$AL$DL$.D-b%b%DDLD$ pb%b%L$DL$DT$ A@HуH=%EI\A>H5M]%I\L9ufa%9tv9=%|nAUATAUSA)ĉHE~_1DH5]%  A9uH@H=)%/Ma%-Ca%H[]A\A]@fDH=1%Ht׀?tA1L-fH= %LD9ufATGUSHH5Q\%w7[%tHQH=2\%H[]A\f.@ǀfDH=HH5[% yH=[HSA܃@H5[%A@A9>Ht$EhHHt$BD`_HHt$BfDH=ԬH?H5 [%D H=H9ff.@x;@ S@tP6tHDX@[fD=Z%Ãuf)[@H1 %HHtH@^%^%<_%^%HtHHY%H"^%^%HHDHf^%1H^%H^%H^%H^%H^%H^^%^%~^%<^%z^%p^%"^%P^%F^%^%J^%@^%]%^%^%]%]%]%]%fUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H=]%HD$HD$ $D$0HD$HHc5w]%HHII W]%Q9H\%H3H=)]%H9t&HtrH= ]%HtaH\%H=]%H\%L \%L\%H \%1H=Z\%u1HH\%H\%t H$‰\%n%1H\$dH3%(H[]fDH=\%Hcq\%HH$IIغHHS\%HL$HL$ $D$0HL$ +\%qHHcH[%H [%[%\HH[%SxHH=[%HtH=[%HtHK[%H@[%Hy[%H*[%H[%HX[%[%Z%:[%Z%Z%[%Z%Z%Z%Z%Z%Z%Z%Z%Z%Z%Z%Z%HDf.SHHZ%HZ%L yZ%LzZ%H {Z%H=Z%61HHZ%HoZ%t H‰UZ%hHY%[f.HH=Y% HtHxHYfHHHT%H~Y%Y%t/yY%%1HAUATAUSHHT%H HHtTHXHxHHcHHcD$*D*X% Y%HH[]A\A]fD;tCHxIIcHcHk覗EHtVH5S%H?HD$*f1oHf.HHHVD1@USHs~_1DH5S% 9uIH5Z%1ҋW%H9ډW%HuW%H[] W%H[]Ðf.H%Hu u fDHayHT@f.AWAVAUATUSHT$0H|$ dH%(H$1Ht$ $DD$DL$4 HD$L\$ W%%5d%9D$D4$LL|$L\$ D9DNLIcHL\$ I+LED94$ ; DI݋$A}t I9|I9D9|$m }c DIL$A<$t I9I9H$dH3%(CHĘ[]A\A]A^A_ U%; ,V%u+4V%"V%fD9|$~oc%Hc$HvA}H|$E1E1L8Ht t:EHHIM)I9|AD+|$ U%r9U%+|U%[|$Db%E D b%ETL1LL)L\$ L\$ HL1M<HD$H)HxLcHD$L\$ II9I9HL$pHt$xALl$XHl$HMH\$@HL$ EHt$(Ld$PLHRf.A? L\$8HDDD11LcDHIL;|$@LcNlvIL;l$HvBHT$(LL$ MMI)HI)EHHIDL\$8vEIMLd$PLl$XHl$HH\$@EMMHH+t$T$0S%Ht$(HL)ޅHt$ ` S%L$8.`S%D$@DS%D$A9DO|N%H=%HD9S%D$@D$ DT$(ED;D$ L\$HDD$@HDD$@L\$HvD `%S%Et S% R%9L$@ZH=c%H ltL\$HDD$@HUDR%L\$HEDD$@tH=ע~~L\$HDD$@H=R%DL\$HDD$@[~|$D oR%DD$@L\$H~=_%)CR%YR%;D$(} ;D$ t$94$IcHL$LDD$(H<H)|$9<$L+d$M)DD)HcT$H$H|$lHL\$ HDŽ$L\$ ~c|$lowTD_%EuL\$ `L\$ u5L1DL\$ DL|$1HcLL\$ HcLLۋ=^%@M}Mt$I9>I95AEA:D$%A1D< DEIII9I9AA:tEE1E111LLL\$ |L\$ A?t|$~5^%IA>|$~ ]%I~9D$0FD$8|$ LL$MLLI)H)H)EAL$A)|$l D$0(EqD==%ED5J%ED$0;O%|$ D-/]%E H%HcD$09B~HR<~L\$ L\$ Lc|$HD$lHt$H$L\$8HDŽ$HHD$ HL$(LZHH@L\$8HUHD%\%|$lEtox?%GL\$8AL\$8@HcAŅ~5Lt$H\$8LM;H5I%H+D$9H\$8MHL$(H|$ LLD%3N%(N%L\$(HDŽ$nHIL\$(LECHL\$ LCO,#D)LL\$ HLI<+L\$ Ht$HL|$0DD$4I$WA@9H%DHc)HpHHHTHH9uDAD+|$D94$Iݺf1L\$@t|$uM%L\$@zM%tZ%D$0XM% L%L$@L$@ L%uf|$0L\$@|$D$8L\$@EƋL%|$89)Aƃ|$Z)Z%AzE=Z%Dօ_E0L%;T$4;T$0!E X%yCD9}H=Ъ%b %tPAD- G%Ev|$D$0 sY%D L%EHcK%H;D$(D9K%HD$wD$DkK%EDaK%VK%D$@f.|$ LL$PMLEI)H)A)EL$A)|$y X%kJ%T$@~;7K%u K%H|$t$(LDT$HDD$@LL$L$H);L$t$ LL)LDD$@L$)LL$DT$HEA؋D$0|$D @H=9%HDC9oD=hE%EEEL$DHDL$)v|$DL$L$~W% D I%D E%EL+d$M)M9Ht$DDL$D)L$HD$uD$DI%|$EDrI%L "W%>D$09I%.I% I% I%9T$05vI%%)HcH;T$()fIMDD9|$IݺpL+d$M)D$DD)|$YV%1L߹D H|$1D)E5V%uE%9OH%) %t|$49|$0HL\$@tD$D H%|$EDG%|$f %*D $9L$HD$pHD$x$vA;HD$pLl$LE1E1MHD$ HD$xLHD$(Kf1DL1DLHcHcILILD;4$`;/LL$ HT$(ELDL uAAME)D+|$%L\$ 4L\$ B%B%A;HD$AB%;D$ ;D$(LE9;%Hɠ%Ht 8?EEAH cD $MHH=%HھAAuD $ME1 0L\$ HD$L1ɺL\$ H)HL\$ LcLt$L1LL)޺A>L\$ HM<H=?%Ht ?H="%H?H bE`EHH=%HھAAuEj1DH=DT$0@%L$E҉@%@%D &A%E9Hc @%H;L$()@%M@%lD A@%L\$ Xl|$L\$ ~5M%DD$( @%ELL)H9L+t$L9H=]@%D¹1L\$PDL$HL+@%DL$H[@%DD$@L\$PDȉ?%AAD1HD $`?%M%E90,H5:% L\$ L\$ &?% ?%A;]HD$MAEH `DL$DD$HH $DD$DL$H $E`DEIϿ A`AuH=6%AEHt#?tLDl$$YDL$D$DD $jD $ډHL\$D $H`HD $L\$A_~ GoA~H|$DƹI)Dzt$=%94$L\$ M)݋K%DD))fAWAVAUATUSHdH%(HD$x1zD9%HD$8Eu)HD$xdH3%(HĈ[]A\A]A^A_k&H 8%H=H=%==%=%+l=%E1-K8%=%K=%=%HN$HHD$H?$H8t <%H<%H;-8%tH=3=%H=%Ht #=%tHH߉h<%~2D,+AE9$HD$H5<%HcDJ< McHD$B +<%HcHD$ <%D$8i<%1AE1$Hd$HPHxHcP@<%HC ՚%؉l$(E1EL9͉D$>DED= <%tE1D;l$uD<%D+;%EǐA<$@I%<%;%A9ĉD$H=;%l$0AH\$@DH|$HHA9FDHD)9%}H|$HA1Dl$0H\$@D$H;$|$EH@A<H$AH@D iH%uC;%s %)H9|$8El$(D-:%Hc%HD$~H%j HD$lL|$Lt$ D$D$@E1HD$HEA9DH@5%Icԃ<$DDkG%]H|$ H|$DG%|$lEtD$Po?%GDD$(L$ HT$5$DMǸHT$IL$ DD$(A9D$PL=$DD$05$HcDL$(L$ HT$I?xIL=q$Hc5Z$I?rxIHX$DD$0DL$(L$ HT$L8bH1$AH@F9D)@A_~ GD$PfD5$DMA95o%D9u -9%Dl$@ApwD_3%E A AA<$}5E%W C 79%o%LcE%zfAA9}8%L|$EC7y -f8%Dl$@L $DG8%AAIyPD9 Mc.8%ID$,D=2%HEHk%Hz8qD5b7%EQ5%7%9||$8~DD%ENn|$8ID$H\$HD$AE1LE>;-6%<7%)Љ‰"7%fH9\$L $IyAH1HDD%6%87%HctH="A)I1D95k6%|L $IIHc| )I9EDEEDC%E=6%6%D9;i6%D9%X6%+D6%5%fDD E EH$HRR=0%uH5%Ht>fQCC7^9_%UEH$CH{pD9AMcBCH{pD9: D$BUAK@T$A|HA΋T$HL$ DH!Hc҃E49ȓ%LcEH$$CH{PD9AMcB,CH{PD9AD$1BLc<$%4B%Dd$H|$HHL$pIcH5/%D)HcZ%HD$@)A)%D) 9D9͉vK7BT JT2Lf HH9uMcLAA?DK<7H H1B%C9)H$A֋CH{PD9RABT5IcD)LcH $)؉ËAHypD9zAL)IcD9͉Ӊ K7BT JT2L@ HH9u 3%Hc=k3%VUUU %D!3%D&3%2%A܉E))E…AD)AA9)1A9E 3%Ht$HcE1< 3%A9~ HD$HcD>D=2%EtD2%Eu9He$%LcI1 W2%E1n2%D%1%H:A1Lt2%[|$8D1%~M=k?%uC5I2%t9 G2%u/E9t*D91%}!D9%1%~D+1%Dr1%f.ۋ51%J%=1%9 )ʋ=1%9N‰1%H$)H0L31%H=,%qHZ$H[$ 1%HJ$,%H5$g1%!1%H%J,%'C 7;%H$CPD94HCAH{McB,CPD9CHH4oHCH$Hxf.H=0%DD虾D) %)nffHD$pD$PHD$1KHL$ HT$D4DAD9T1D9׉DH$C7CPD9 HCA1IcLc,fH{CHH4nHCH}$CHH4lnHCHQ$HxH5 *%HL$pH|$lDl$HD$pҋ%HD$DT$] HI耿Ht[/%LhtMMHH$I)DZA~ H$x t(H=!%HtH%P9.%L(HÉq.%E9d$qHcH\$LJ<#zHcU.%HD$ 6.%D2.%0.% |$P %D$4;9A9u -@.%Dl$@HD$H4H9s,I)HM@H (% A HH9u)LcD$P1҅Dd$Lt$(AL|$ l$PA5AMcF$CH{pD9~~D$1BAD9tK9%HA$CH{pD9CHH4.lHCH$H{DDL|$ Dd$Lt$(%CHH4kHCH$HxZDD$(T$ CHL$H4kHCH$DD$(T$ L$H{DCHH4tkHCHY$H{?DD$(T$ CHL$H4?kHCH$$DD$(T$ L$HxDT$(DL$ AHHL$H4jHL$T$(DL$ HAH$HxB@)څy D911E1ۉ+%11菷H$HHtH@+%*%+%*%HtH7+%fDkHH=3%HD$**%Af0H$HDT$LL$AAHH4iLL$DT$IAL $IyHyH2*%DH|$HA1Dl$0H\$@H=~*%1ɺD$l$0H\$@f.9DuAM_A)Dd$TL|$XMcHT$0AE>fDAIcDEH}pD9Y%1DI9C3 =%DD)ED9H-$EH}HD9T$L\$EHDt$ H4jhHEH-O$DD$ T$L\$H}PH)$1HH$%AA)IcD-$H;hHH$Hc5$H;gH(%HD$Dl(%DfD (%D9{(%~D)$l%$=](%@D-q(%ECAAA9‰EUMED1>L=$I?%))Hc5$fIL=$Hc5$I?fHD$I8D9AA)='%.D95q'%3%9['%!E54% '% &%D9+'%5'%)Љ)91+'%&%DD$(T$ EHL\$H4HL$eHEH$DD$(T$ L\$HL$Hxf.McT$Dd$TL|$XHT$0ˋ%Lf. &%EH\$AoD9~[9|WEfHQ$HPLc$L '1L;-%%=%u L践H9-%%}ED$@9%%D%%|$8t73%D$@w=%%L-$-%%IED D)f.|$8~2%_9-%%L-h$IcIuD9V%%;->%% <$=ƃ%~$2%u)%%@H{CHH4cHCH$D$@=$%D%$%AV$%L-$-$%IUD"D)9|$8D-1%E)؉IP#%fDL-A$HcD$@-$%IUD$D)Dd$H$IcH0Ƚ莳HvV1%#%t #%P#%9+H=#%H=,%HtH0E&#%tH=s[OH=#%DLO|$8y#%D5Z#%L-c$-#%~D=0%EED%"%IED D)"%@H|$1DT$oL $DT$IyL-$-9#%D%"%="%AbaDH$Ic1H8հ+"%9"%9"H="%D1螰IU)D"%D"D)9~%Lc3"%DE}HCH=r%Sw=!%!%ҿ!%x߃趿1u1[fDH=I%HtHCMf.=!%St !%t+V %MH=x%[!%[fHA$HcHJHHc<u= %E$tH5$Hc %HNHHcT<);=%{H!!%HH膺1HcP%H5%|H=}%HtH@衬%H=8%HH=!%@ }%%H%)H9%t1~Йf+%H%H!%=L%̀HH%v$H1H%H%HfDH%f.ATUASHHHH}dH%(H$1蠰H;DŽ$tHHDH$dH3%(u HĠ[]A\轭f.AUATAUSHHHHdH%(H$811H$H$L$$(H{HLDAH H9fo$H$)foD$H)CfoD$ )C foD$0)C0foD$@)C@foD$P)CPfoD$`)C`foD$p)Cpfo$)H$8dH3 %(HuHH[]A\A]H9,$e菬Df.AUATIUSHHII|$dH%(H$1HLDŽ$Ht%H$dH3%(u!HĨ[]A\A]@LH@H@H$%Ht HDHÐf.HD$dH%(H$1Et=t%tp5&$%$t  $%t&1H$dH3 %(FHĨDHA%H5#%@H=y%购H=m%H=\%ҳH=K%H=:%谳H=)%蟳H=%莳H=%}H=%l $\%5 #%H=?%H3%H5%1ŦH>"%H5H!%H5H %H5}Hv%H5oeH%H5WHHt b %umH%H5'H%H5H%H5H5F%1ҿ!%ХH5a%H4zH5A%HQ f.SH&$dH%(H$1t =p!%tj$t =Y!%t'1H$dH3 %(HĠ[DHH{,H5%Hڿx!%@H|$H5W %H5% H5%H5%H53%H5%H51%H5%h %§fHH`$Ht-Hf.HA$HtH=2%HHWxHtH@!{Hof%f%u %f.%t@H=i%H耩H=%tH=M%裯H%H55%1.%HDf.n%u@H5y%H1ҿC%Hf.USH%dH%(HD$1t $uHD$dH3%(H[]tt~%u%=u>Ã@D$^@9ueHDhtSHEt1T$D$H|$yA^@:%D$^?\$D$QUSHH %dH%(H$1HXs%HtH5Ts%H?s%H1HUSH9~){HcHcPHcH5 %HHH[]@f.5 %9|FH %S@Hlj5 %HcP5s %Ht %9~[骩f.雩f.o%AVAUATU-)n%SXH 2 %9AHc4I@~t`@ x@ nHyHHpH)fTAĀ / &HH9uHE1E116HLDDD9DC@ @  ЃD9@H@u@~t][1]A\A]A^fHcՀ<~,H=bwIĉHJLOfD1E1E11iD)}HcHcNH5 %IHHL2A.LLHzODH}JHeO[1]A\A]A^f.AIcIH4LcAJ4)Lf.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H=W H $HD$HD$ $D$0HD$ΦH=$HHھǛH5$ fH=$ʢHD$dH3%(u H[wSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H=U H $HD$HD$ $D$0HD$辥H=$HHھ跚H5$ VH=o$躡HD$dH3%(u H[lff.AVAUATUISHH HHA9@HcD4HD)A9"HLHuH[]A\A]A^@1H[]A\A]A^f.H6H?uD01 @Gff.t1DSإHHc[xf Dt1DS訥HHc[xf DUSHtH[]kHHcDhtIHH[]f.USHtH[]HHcDhtHH[]f.t1DSؤHHc[DxHt fD@f.SHxHcJHH[AWAVAUATAUSHH5%H=%H.%DhIcHHz$L0L蠚HI蕚I|IEILH4HH)LAJH9JHR%L<Y@HD-,%A tZA]%HcHHHIH%HH %=H(D-%H1[]A\A]A^A_H?IH%HpPHfHJHHJH9uA Hf%1HE1H%Hp@HH%LHD52g%19L@[1e%]A\DU%1fDxLSb%C5b%9u=t$t1[fy=t$uRb%[;b%1 ff.xLS-b%C5"b%9u=St$b%t1[=6t$a%ua%1[IfxTSa%t9B5a%9t=s$ua%[a%1D01[x\Sha%B5]a%9u=s$La%t 1[fDQ=ns$,a%ua%1[6fDH 5`%1`%`%! 1Hf.HD`%EH $NDDOAf.HcD< t< u8HcƉII)f.L9ƉM`%tCTH t tHcƉII)TH t t L9Ɖ `%uDDOAoD=$r$t1H_%_%1HDOAtDfD.1Hff.USH_%4ADOH=$IHOfAAHcƅTt/w4Is.HcƉII)DL9_%Tt/ A Au/tHcƉHH)H9ʼn^%TjH A AEO/uAAJ=p$tH1[]HIJ`_^%I^%H1[]C-H1[]f.H=.^%t:1;=Xp$^%t1HÐ]%1H,1Hff.1fUSH]%9]%N]%[/:]%H[]ÅxLATU1SD%g]%-o]%>d]%1J]%>1[D%6]%-@]%]A\@ ff.xLATU1SD%]%-]%>]%1\%M>1[D%\%-\%]A\@If1fAWAV@AUATA@US1H=H 8$@I4IA@Ń~!L9th@E4t HSI8tjL$u L{uL9t#A @ljD$ uD$ 1A MLLr=IDH=NMHwH%q$I9t<LA7L=H[]A\A]A^A_fDH%8$ҐHsL$tY3$*$tNtC$t8HA$HЋ$=$%$tƋ=$ fH8L蹂tdH$dH34%(uKH []A\A]A^@HP$tD$d@AVAUATUSH H=$Ld$dH%(H$1}LcL1HHL$HLHL芀DLA ?)HH lhH ĐHc $A~1LILH$HD$(H$dH34%(uH []A\A]A^x$9$f.@f.^$T$9~0)ȃtx.<$H1$Hc@<)Ɖ $Df.$x=$@f.H$Htf;f.Sǯ$x=$Hx$HtЅx$[DfUSH-H@(HcU$5K$LC9taL7$E1 fLI7L9Xu6HcA8I9tRPAAMHHH]$8t$HA&HH[]H-Lc$IfHc$$9~?)Ѓt0tAJH$@< w$~ f$@)=:$H $ AVAUATUSH0H=J$Hl$ D$ D$ dH%(H$(1 LcH1HHL$HLHLA,}DLA ?)IL l } $L ĠCA~LD$H)Hci@BHD$)1HcHL$LNyHT$ THD1A}Aċt$ $$9E)9}D$ =KAD$ u=,@H=$$lj  D$ PT$ /$t=%$`fD1H$(dH3%(H0[]A\A]A^D}1ҾD1D$ yAžD1nyHt$ D|D$ D1DFyt$ tMD R)ЃfDt |$ f fDE  1@8z=:$H $1ff.$H%[$1S$tH%:$$[@CuH$Hu$gNG%$H$HtHc$9$`uҋ0$t=&$aHce$9[$u1H=$t$Ë$L=$!<@PH $$~$붍PH $$$RF%u8u1$à fDAWAVAUATUSH(dH%(HD$1HD$HD$DnL|$Lt$IIH v$@kH%f$x)ADLHLL xHt Ht>Ht)HT$dH3%(uKH([]A\A]A^A_A$@HD$HL9HD$k1wwAVAUAATUHSHc1HIHdH%(HD$1^xExaE~\I5f.H x$@#AH%f$A9HtDtLHI$tHL$dH3 %(Du H[]A\A]A^vH藊$u(HN$$Ht=9$Ћ$u%0{:$uHÐ=*$HafSHwzHxD%H $1[mf.USHH=JD%oB%H=B%1HC%)=$oB%H$)7$oB%)8$oB%)9$oB%):$oB%);$oB%)<$oB%)=$oB%)>$oB%)?$oB%)@$oB%)A$}<6$fov$P$H)$A%$fo^$HB%A%foX$A%foY$A%foZ$A%fo[$A%fo\$A%fo]$A%fo^$A%fo_$A%fo`$A%foa$A%t:H[]ÐH=$4puH$%H=R$u H[]fH=!31 qDD!$EuB_=$tؤ$ fA%$5$Zd$H$= H=$o$H=$$Wz$D@%EIyHH$Ht$H1A%H$8$#H= A%1 =z$=j$gH=$H7"H$"q ueH$HEH=~$H=|$H=e$H!HL$yfDH=$\-Ht:H=$H{-H$% sHZxZ$FDfDH=$D$E9$ H5$r-xD F$EH=$:$w=?%:H$uH%H=t v@f.HF$H%$H>%u4~$t"H$i$HtH1H=$-뿐f.S H@[f.H9$t:Hu:uj>%H$ fDH=)$1bhH$t H%H$H$HH%H$ƐH=$1H$f tH%Hl$f.SH5<HN$H=N$H=$>H5=H=h$>H5H=M$>H51H=2$>H5H=$>H5H=$>H5x%H=$l>HeN$[H5)<%n@ATUSTHdH%(HD$1HioG$KA<%<%H=cH<%t 1Hp‰y<%=[<%sED%A<%DH=X$H=,n5(<%lj<%<%PPz $;%tk5;%=;%X\$<$5=$Aۉ;%=;%75;%s %$u$u 5n;%HD$dH3%(=';%H[]A\Åۉ@;%=*;%uE1 ;%A܉;%H= $H=+Nm:%zH=aH=:%tHǺ 1nlj:%RD5:%DyfAji:%O:%AkۉJ:%/Ht:%Ht :%@HH=$n1HHH=$nHHH=e$`n>$tHH9$uF$tH@HtH?Df.AVAUATUSHdH%(HD$1HHH=$E1H;9%H8%H9%HtmAHbHHDHKH9L$H=$'HtfH=$Htf58%H$H$H$2$x8%y8%C8%H)HA8%Hv8%H7%H8%H(HZ8%H/$H7%H 8%H8%H$H$H$H$Ho$H\$Hi$Hf$HK$HX$HU$Hr$Ho$H$H$H6%L$$K$H6%H5$H $1HL$dH3 %(H[]A\A]A^1D 6%6%O6%hIf.HH=$HH$HH$DeH=$H#H-$H='IL@H;HkHLiI9HEuH5%19$Ht+$H5%H=5%H $H6%Hߚ$H=&cU5%m$5%H=5%XH=Z&$>c1҅‰$uHl$Hi$H=R$H=V$H=F$&H=E1!\H=$HH45%H4%H5%H4% eD1DfHH$H$f.H=7%$bH%H24%dDH=p4%1H=X4%seSH=$tX~D3%~`$53%t53%53%H[53%DH[fDH= $t$ Ht$ 뒋53%f.kf.$tyAVL5#AUIATUS1D'H= $DHHt>HHI<D8'HcuLfuHp#H[HD(]A\HA]A^[1]A\A]A^1f.H2%2%s1Hff.H 1%Hc־kff.ATUH=d2%SHt>~-1L%qH=A2%LQa9u[1]A\fD1ۅ~f.H5Y1%c9u[1]A\ÐHH551% c1H@$tvHC$tt 1HH=$Hu,H5$dH=$/g1HH`1Hf.r$t6H=_$Ht*HCH5`$HfD@f."$tH=$Ht $ufDHH_a$H@u$H=$Ht$H_H=q$Huf.H$Ht4H $Ht(tH[tHL_@9=A$ufDH0_ATUSHDaH O.%Ač<;=O$Hc=/%9*HcMcH9$4HHB4Hc=.%9}H=$HcHZ^$t0.%H$.%-%-%H[]A\Ã5.%uH$Htzt3.1ɿfHc=\.% z-%9@eB 9uƉ+JHJ j@`USH=.%%f_HH=0$5-%v $ ^|)-%u.f^{ۉ-%_HH=$5{-%v?$u-~H=$f^v{蟼vۉ7-%n$_HH=Y$5-%v$u}H=6$ft5,%H1[]@}H=$1D?5,%;5+%SH=$zݻ5w,%+%9u-;5+%5Y,%}_H=$sz蜻tH3^H51,%vNj$uH=V$z;5++%5,%|t5+%;5 +%I1[D*%5+%9PH=$y)]H5+%v[$uH=$-z1fDAWAVAUATAUSHXdH%(HD$H18]Ht-$CDl$0D$1=AA AD|$Hc EI~3Ld$0LcIADLLLJZIDAM;D$|AD)t4EDNAMHADtA}tL,D)uL1M $Ht$HdH34%(|HX[]A\A]A^A_fDD=Q$E F$ALcL$H=$HN$H|$(H *$HHD$ErMF,LT$IcD5$HHD$3\HLT$DHHQD$0D%$H$DC=rݍ{Hc I~5Ld$0LcHAfDHLLXHIcAL9LMR$tA?ugL1 ZHt%$u|$0$~z$t?ED$/Dl$.u1^LhfDH|$.1T<tD1uHD$H$f.Hl$Ld$0HLH]D,0d$D@a$H5[$LHD$1D%3$D$0\H$KDH|$0 Zff.USHH P$@HD$HH࿅H2$x`u;t$~Hމ[]H1[]DH$ufH[]@?1H$$BfAWAVAAUATAUSIAH&%K1D$ fDE~ 9%%|$ H=$1ɺ?u1ɺ*u9É„t>%%H=$ELtuQ@H=w$t1҉v9É„uEtLd@[H[]A\A]A^A_fA@uEAtPE%% H1[]A\A]A^A_1vIAt;%%nH=$1҉Ov랅t۽D$ TH=$1ɺ tAUATAUSAH(HHdH%(HD$1~ x)EuDHL$dH3 %(uEH([]A\A]Et׉DHfDDHډVWw?H-$$>@f.Ht ?t!1f.AUATAUSH9~Aŋ^#%D9}9AODID)L2#%)9~=LcHcAL@L)$IAM)E0HGD"%A)E9Ӌ$t9H"%H$)"%HH[]A\A]fHD1Df.b#%"%9~ R#%t8#%9|x(fDy*#%։#%f"%DATUSI9~,"%1A<$t L[]A\uf@AUATAUSIHT9Ϳ$HÉH=ÿ$LKRE!%n"%9~"-d"%N"%9*x>H[]A\A]y."%4"%9~։-"%H[]A\A]!%H[]A\A]聲b@3- !%lH5!%H=$sp5 %9 3$ty  %H@HD$H93$uH=$7r5 %Df.xlN!%t9()@!%1Dy*!%1H!%!%y  %1Hf. ff.%t:= %~$ 2$uH3C$H92$)щ9|$= %x 1%1Hf %Y%y q%1HfDUSH!RHt[$uQx}t; % O~H=-$ƃpu&%H1[]H[]a%H1[]H߉[]fUSHqQHtK9$uAxMt.%9W%u =1$tTm9?%t;5%H1[]@H[]AH߉[]뾐f[f.f.%1%%1Ðx w ff.x ff.AWAVAAUAT1USHXD%L%dH%(HD$H1Hc.%xIcADHD$(D9HD$(E1H$HD$$HD$HD$0HD$H=$lOHv5$Dk AOHt ]$u @ŀKAH$@,IcA9n1D%M%HL$HdH3 %("HX[]A\A]A^A_fE1EtSOHt$u@ŀD$H=$kA NHAt}$!/XHHcHT$DPKHT$H,@WHHcHT$DPWHT$H,Dt$H5d$DH $H|$)HcHcHxNHH\$$ڃ|$׉T$QwT$VU9dH$H|$RHc~D0H=۸$Ht$HK/f@ŀD$>fH$(\$$[f.IT$T]D$$11 ZMf.HwP[H5)$1W1Ke&c$1HDHn$u"mHVμ$1H1H@HH $$@@PvH% $HATUASH $@H%߷$xGtJBti~{CDLHDv-$1[]A\DcUHHcDjt_HHBuD1[]A\ÐAuD1[]A\1y[]A\fkKHDv -.$t&1ff. RfDBfD~ 1f.H$t#.H$HHy$1Hf|$ Wr$|$ u1HDf.~ 2f1f.HD$g%Eth%;%{$=*$H $tI5{$t 1%t$t1H.%u1H }=M*$mu'mDrfD1f.AVD5%AUATUSE11ۅAA~fDD@Hcq%H$<H&ZA9uJA~A5F%DV8%;V%} \&%i[1]A\A]A^fD$5%uDf[]A\A]A^D \f.AUATAUSH-%;-% D%3$EtNqHHDv4$5U%E1c-E%HD[]A\A]#HH=!%v $t]wHD[]A\A]fAH[D]A\A];cfDH=$Xd=%@f.AUATUSH(dH%(HD$12]訾1HL$dH3 %(H([]A\A]A&GHv$ 1I!fD<$uZ %9%|79tFHv $tDc%9%}DfDLXfDHD`iFfDUSH=&$1ۅH-@w$tiH$u\,uS1tHx~kHHV&$:uQH9juK=4&$ƿt#ft# %tH[]@cuݻl@=tԉD$ H.H?$H$$D$ H[]D @ff.xTATUS:%t. -۰$t?5%1+[]A\@[]A\1DH5%H $t $tN~Hc׉=%D$V%;%u#NHADQ@v$u(1eH3cމlja%DAU\-x<.%t\$$t[HHD9f%t;%tf{f.5%SH=ڮ$HcD< t< u6HcƉHH)@H9ȉƉu%TH t t܉ x%9Hc< t< u4F)HHH9ȉƉ%tH t t9t-%y %1[fD1@% %1H=$eff.%t;%tf[f.ATUSHu%S%$HtPtMtA>uSD-%1ŷL]LU$[D5W%f.LfDLfD1& %ATUS=) %- %;- %>?H5 %v$F)ʼn %}HcI~;u1Hf %Hê$HcAHH9uHcL=f %4/5X %H=$ڹ[c %9 %9~E/ %MtA<$uKfL[1]A\[]A\ÐfDy %LfDH=$]f.>H5 %v ]$tn- %H=$1]f.t Wf.۩$uHGHH$HHHKH$1Hf.{$uxHHH.$HHHH$$1Hf.9= %|=U %1f$u=H %;=f %=% %1f %;@ %~" %HHDt % %1 %fDSH=2Ht&8t!1HBHHt8uR1[fDH=|2Ht8uH=nf2Ht8u11SBHHHD@H=UtV1ɀutC $x5 $t $ H$$w%H[@-t=W$uˤ$MOH5G$H%$5H$t%D$ ,j$D$ H[f.HP$ti %1Q :$S$$%$91fH@Hգ$耾H%ƣ$LNH%$x.H5F$H[:Gf.%$H&f.=%1~1G$t(=$@B~ uyHHfDHIH$%u$g%H€H͢$t 1H@HG.$($$%SHHq$%H€HU$u輼[fD115$H=z15$H1[fDUSHcøxz%u1މH[]O%JLH%$H1[]fHrL$ $1z$%HHt+SHH?Ht2H{Ht|2H[s@f.HGH=$HtH$HfDUSHHtGHA$H9Xt:H-\$HډH H8HH{Ht1HH1[]HH5$Ht@H81H=$HGH̭$%H$%1HÐ1H@H=ر$t1H1HH=$Ht$HH$1Hf1f.SHH?1bHCL$%H$%҉%u%%[DAWAVAUATUSHH$H3HxHHo1H-$I9%A<HE1HDHCHtqH9HID11,H=\$HCtf.苧H=;$uH;Ht0L=M$L3HxLH0HHHuDH-$NL1?;HL[]A\A]A^A_fHAVAUATUSL%$,%~JIŻE1IlH}HtL9MD6HEHH9r%[L%8$^%]O%A\A]A^@H 1HfDUSHxttE|c$twH=$1rfHt&HuH11r H1[]@Ht HfDkH1[]fH[]ffDR$ p$u(qb$fDsefD9DِSxލx[f.Sxau1[b$t(HtFuH1101[@$ $u(tĉ>b$@[f9DfH$$c1HHQ$c$U$H^$$u1ÐH71HÉ=*$f$t1 $1fD5$1fDHH$@H$P$P $P$t@HHGHʬ$G$G $G$t $fb$X$AUATUSHL%w$MtRI$HtIIE1f.H;I.H{H.I\$AHuHD[]A\A]HE1[D]A\A]$f19=$|xH=$t=$@fDH$Hc}$;{$tH$HtH1f.N$tHw$:$HH1D$;$tHC$$HH1D+=^_$9=$~"xH$HtHcHf.1f.ATUHSI|HHtH\-HxcHH+HH+HCHLc[]A\@f.Ht+USHH_Ht y$8t1H[]1DS*H{H1 /}"ufHt[Hc$~PUSHHH$HlH}Htm)H,HxHH1*HEH[]fD@f.USHHt5HH?Ht)H{Ht)HHkHH[]Ð1ff.AVAUATUISHPdH%(HD$H1?$tOHc$$9b$uD  HcH$$$P9aHcHLm1I.LGIL@?1'LH!%tDHWHDHL)HLH(M$HLLH-$H*J*$HD$HdH3%(HP[]A\A]A^f$E1Hڧ$tH=$HHtHHcv$H=$HwHj0Hc-[$[$HHLm@2H=f$X$HH4Y$HD$n ')ff.ATU1HStDHH?1LcHMtL)HxLH0'IHCLeHEH[]A\fAVAUATUS9=r$Hc߿IH1IH$HL, )HxHH&ImMt$I$H(HxHH&ID$H*$L$L[]A\A]A^fE1[L]A\A]A^ÐAUATHcUSIHH$H,LmLy(LHn(HtL.Ht,HE LHEHH|[]A\A]%fH[]A\A]D|M$t9Li$MtxHcIHtH9puHPÐ~dDHI1IfHL9t'I HtH9quLcuHQf.zEqKfDxT $9~JH5ä$Ht>DALcJD)HLHtHJHHJH9uDX$1DAVAUD-;$ATUSIA9A)A1AEL4f.H1$H<HlI9u$D-NX$H $)E~\HH41@HHH9OHcH H$[-$-$$]A\A]A^1ff.$T$uDr$f.^$f"$S~4HF$1@H<H0$SHH9$$$[f.LcBMtQ<'tMLcABt+<'t'<\AIutB|tAILcABuՉDɉf.AVAUIATLcUD)SHc~at|L5Du\|HcKt%HHHL"H|D:D Lu"[H]A\A]A^fL5tL5떐L5fL5tDf.AWAVAUATUSHcIH/tIDH=D$HtAHD[]A\A]A^A_{-L ADDt-AIvIcHUADDtqH\.AuH=-DA$H@AT.8&>&$]IcAuPDD<\؃<<MAGHcAADttXAGIvHHADLt?TADŽukIc11ALAD.<-t#<<AcA1-A-AGAAWAVAUATUSHHH L$+trE1HT$0t$,EH|$1HD$D$I< l$ t< H|$IcHTAIք< HRt< tE8$L|$DL#A9ALcD)MύSHcHcҀ|$+tD$,A9A9~ HD$0|$ 8E9D$HD$L,HHJ (HL$ HLHvHL$ HHD$JD(AHD$HH[]A\A]A^A_@HaQ$HHAEHL$HL<H\A7@Hl$8AHHfHHmuA@HHuMcHL$Hl$8DD)E̍SN< HcHcD$ H|$Hct$HT$ HsHT$ HD$@HD$Mc1ۺN<DHl$8IljD)ASHcHc\EMAԻ8HD$f.AWAVAUATUSHH8Lc&HD$ Ht$T$dH %(HL$(1HLD$H$N<#DHD$ 9AML${9D$9MD5A?\UuBD+;D$DLcN<+AtH;D$Hvo$uH4$L7(~LcN<+Au@A9| |$ ׉$D)Hcm$A9 f.@|0HA9E}-McB<#EN@\uFT#D;T$uMcB< ENHcHH\$;A?u:H\$H\$(dH3%(usH8[]A\A]A^A_@u;D1A9/1|$"D|$tDH1pD1vH1WAWAVAUATUSHHT$ HcdH %(HL$81Ht$H:M$D`IIcH4D>Ht$D8KA-AG< AME1McAG| DI|AAG< vHD$u:M$$)HHHL$8dH3 %(HH[]A\A]A^A_E1A?uAAIcLD8HD$E.HD$0DH\$H$ifA:H=DHH=$HtDjH;T$  HcLD;Et1Hv\$ Ew<  L-ϔ$HEfDH.nMI<$HtI\$DHH{HuLE1L렿DE1H\$I $LH$$H$>E1Nff.AWAVAAUATHUS1҉HNHnH8IXHHPI|uLۉHBL5EDHу$Atl9UA$DDA9s u xA9~WE1t!ELIlDH;HH9uLHL[]A\A]A^A_D1f.IcD)M,E1HM|LH;H|L9EtuA~E1Hcs1IfDxHA IcA>IuLII}$DL9u11E1(If.AWAVAUATUS1HdH%(H$1HHt$=NF$ILIAHʼnD$ :F$1ۄHDŽ$DŽ$H$HD$H$HD$F\AGu A"5$$HAfHc$HII<vD$E-$ElDQE$Et8D8`EtH=H==D$DD$8HL$0T$(Dl$$HDL$$T$(HL$0DD$8 D8D5$AGtb"!u '\A't E8 @Ht$v+!Hc$II<D1$@A"u H$HDLЅiHc$AD%C$D8DŽ$MH$1D$D$<D$$1D$8D$HD$Ht$PLt$0ID$9ELcD$CHcЉA$C;D$ $:T$HAuHvn$:EB$:$t!" D$$tύ$$t'HcAt@H=A$H|$ )߃Hc$Hc$IHLL)DlD;l$|%t$DL)HcD$=IHcLDLy L葿\$ C;D$ $fLt$0HD$M9L tLVDD$8E[|$H1ۅK1E~ 1A|$Ht$$L1$f)ىfD8bfL1ƾLHxLH Ht$HDAGf.Hc$MtIAt(H=9@$ Hu"LD$$AD$9~UHc$ELc݉ACHcA$JD$@LHct$~IfDD$@LHct$^If''\nD$9W ELcD$C\HcЉA$fDfH$H$È\$@l$LHt$(L$)$HIH"$HI9މ$HAtIELH&t\$@l$LLl$(AUI!%tDIMLD@IL+l$(IAD;l$|%t$DL)HcD$IHt$(HcDL? $D$xHcmI=$A:sIfEOLAGA ED$ L$ DŽ$HD$M9L  L޻D$H+D$$D$$D$9LELcC"HcЉA$D$$tNH|$@DlD;l$|%t$DL)HcD$IHt$@HcDLNH|$@d1|$\D$8^HA$D$~LLGl$`AD$pD-|$:1ABHcAJЀ 2$$&D$@LHct$XI|$(L|$x$L$D$D$(dAL$D$HI舭IAIcA^Lt$0D$AٹDDL1H|$@HAD$-ALt$0C|&LcˍX{AIG1Mc EtJBTIJЀ v$9 H=8{$H5{$Ht >~{$yHڸq@v uHt t 'uڃHcIHP'H1@t%H@'t:~@v@ t@2HHuf''qHB'@r'\''HH_$Ll$PLpLHc$LI|;$@Lt$0$Iݹ$ILt$0$A$D$aLt$01ɉD|$pDILt$0HE1HHHT$pHt$`DHHHt$`HHT$pHH\y$DHHHH8y$E1Df.1ҾT@ATUSIHHHdH%(H$1H~IL;Hx H?LHHhǾgfffA+-A D))Mb)0L+D))Q)0L+D)))0L+D))ƍ)Ɖ0D+)HD+0@|+.tmp@HH$dH3%(u H[]A\RfATUHSIHHHHdH%(H$1H~4HLeH$dH3 %(uH[]A\fDHL5@f.USHHt%HmHxtHHH[]H=5$HHtLH4x HHcHc3HH/HHDH.historyH@HH[]Ð1ff.AWAVAUATAUSHdH%(H$1ہA!H8HT$0HƿIcD$'1LED$XE19-$N-$l$ HHD$(i$)9=HcD-u$)L<1HHlEI7t&H~Ht?tHt$Ht$\DH>IL9TuHcHD$H|$HHe$+T$ 9~zHL$(Hc)D-)u$1HHDLH2IIGH8(L;|$ZHcD uHT$|$HHHѦD$ |$t$M%LLLJt$L~Mt@Lq6EtD$H%=D$'DH$dH3 %(fH[]A\A]A^A_fDIHxZHcD IHcHcHɥD$ |$s$yufD3M1ۀ|$'T$Pt$LL fDLHIHǺ1;D$u}L#fD|$Mt*LLLfDkL@HD$'D$'vf.AWAVAAUATUSHHr$dH%(H$1H1HHź1KAy$H(wfDHT$ ƿL|$PIE1D@HMtLKDH$dH3 %(vH[]A\A]A^A_@E1uUE1DeIHILHDuIy.u@DE10DDp$EIcEHLAuEu @#UA8D$tX1p$I9MLE1fDL9A9}zA7I@ uE83ALHT$@t$DD$AMHDD$t$HT$DHq=o$`YLE1DH9v{HE1 HH9vg; uH9v { Ct/:go$MHT$LE1HT$AE9~HHD$D%Mo$to$H1pLhDPkHT$DD$AwHLDD$HT$Dpx n$HT$ubHT$@f.HT$H|$qH|$HHT$wDpAIfC$HHT$HT$@t$DD$AMHDD$t$HT$DHtm$#A#D$D$^{f.1d@AWAVAUATUSHm$dH%(H$1kH1HHź1Au^1D ۉZm$EHDm${H$dH3 %(DH[]A\A]A^A_@HT$ ƿt:D$8%=DAHl$@D Dl$EJHϞRf.KD ۉtl$E1_l$薞Ld$PIqI|$HLHDHD$DIXAHL$IcDžHD$LlL95k$MA @EMgML9MA? uA8uAfD1ѝT@SD Dtk$EE1@T$@t$IcDmIfDAIAIE:.uHT$LH!uEDAhE1f.1ffDAUATAUSHH艹DA莹1҉HRthDnH[]A\A]ÐAWAVAAUATE1USHHHdH%(HD$81HD$09AHD$0E1E1HD$HD$,HD$@DHL$H|$D)IcHHcHHt_Ee$|$,t ov/?b%}uGvmT$4T$EEf.AD9tEHL$8dH3 %(DuSHH[]A\A]A^A_A|_~GwfDEHD$EHfE1fDUSHHHoHtJH1HHHHt!HtHҸEH[]fHH[]1HHcH¸HtHuH[]AWAVIAUATIUSHcIHHHHELL$@LL$~'Ic։LLHHT$9u 1H[]A\A]A^A_HT$8u܃~BAAMcMcC7C8D%uuH H:LuH9u@f.AVAUIATUASHA9EEA13HHH1 HPHvVHED9}5DHc)LHHcu1HPHw˃D9|fD)[]A\A]A^fHE1ܸD)1D9|IE~5HcH1@87u6ApHDH:TuH9u1ff.USHcHHH(dH%(HD$1a$u P9HL$dH3 %(u8H([]Ð)HL$H|$ HcHHD$HHwD$ f.AWAVAUATUSH8dH%(HD$(1HD$ IޅLd$ މIAL9؉HD$HD$f.HcM|5LHtjH|$LHLHHtHEt:\`$|$t ov?t%}GvtfDuEudHL$(dH3 %(H8[]A\A]A^A_3DI$뫃A|_~Gv@HcLt$LH5%{GobHcLHHLHLHH@H0F_$|$t ov?~A|_Gf.1IfHcAVAUATUISHHMHt>A<$t7L|IIcHcEIt#LH}HcՏI1I|-Hs[L]A\A]A^AUATUSHH?~HG/L1MM,$MM|$fDIMoMLLHHqu l$D$]}HcM$.HcˋHHLH*+HHHt HHkHL$,;l$Hc|$HH|$ H89l$ vH;/ dl$1ҋL$9L$MD$D$L$H|$HT$ DpD$Hc\HT$ HD$xDIL9t$0l$<DHD$HcM4L$4L$H|$DpD$HcHD$f.Lcl$HD$B(HH[]A\A]A^A_1rHcD$LHD$fHH F$H5> $H=? $MH F$H5/ $H=+ $H*f.H $HH1HHt-HHwt,HuH=X>0fHH E$HH0DHruHfH E$H5R $H=N $aH E$H5s $H=o $BH E$H5$ $H= $HDf.H= $HuhH 1E$H5 $H= $H E$H53 $H=/ $H D$H5 $H= $1H@두f.AUATUSHHHdH%(H$81H=}G$HD$t.HxHHH|$HD$IG$Hl$HT$HH= $Ld$rLrH $HH{tjH C$H5| $H=x $H{H C$H3sH C$H5U $H=Q $T1H$8dH3 %(hHH[]A\A]DDD$(Ld$D%==td=@==L==`= Z;fDAiLH HT$IHt,HL9wHsLH)HH[ HuջPAH$HH5L $H=QLd$LpgfAt'tL<AIH|$ PL`fDLHwH=$Ld$QLAD%=AtOtAL0|8LQ@AuL`2DD$Ld$D%cfD>YL@r@_OLt .`}@f.H=$H ?$HtH5$@HH5m$H=n$|H ?$H5~$H=z$]H ?$H5?$H=;$H:f.LAVLAUATUHSALE1ҺH~=tB\tX^oAHM`DiA>wdIIA AI=u9MLL&LU[]A\A]A^AHM`xDOc,MA?1Eh0MEeAA IAI3EhME1DAMЀ6w/IIA~IA~fDE!IAI@ A IAHIMIALE(IfDAIAHIMIA IAI`t:uMĸf.AIGd%E( f.AIGd%E(f..fDfDfD fDfD fD fD fD fDAIGd%E(:f.AWAVH=AUATUSH(dH%(HD$1HH$t8Hu5HN$HD$dH3%(H([]A\A]A^A_??HD$fD$L%kH-\#{HxHH'H@N$HD$H$*l:mHPH$D8D|$xHPH$PT$HPH$x=1LLt$fDHHtHtCD:>uL]uH$HcH|$H1HH HD$HAH=1LV1H$Ht.t~:tyHHte:t`HH$uH=11H=M$H=M$HtH_ HHuHL$=$4fD:H$*(L|$I}HHL$HLLH$HL$HC HD$HC@H$HPH$8=t6HsH"H=[130fDHH$HD$HK1LLHC>7름MRfAWAVAUATAUSH-9$dH%(H$1u K$u5E1蝂H$dH3%(DHĸ[]A\A]A^A_Ðf#$A]Xt!A}A)ADD$[xL5}8$HcÅL=q#AA t89t@MtLL$ L$ HEtHcÅA uȉwHcA,MtL]HuA99l$uAuLd$ DLHH=(8$#H=8$HcML-c$]$?)ѺH #H T C)Hci@BHD$)HcHL$t#LD$11L-$.AvD$({D${k@f.SH#u|H)HPHi#H޿] ~/.bashrc%s: invalid option%c%c: invalid optionlogin_shellINSIDE_EMACS,term: (term:dumbemacsPS1PS2SSH_CLIENTSSH2_CLIENT/etc/bash.bashrc/etc/profile~/.profile~/.bash_profile~/.bash_loginFUNCNAMEBASH_SOURCEBASH_LINENOmainetermdump-po-stringsdump-stringsnoeditingnoprofilenorcposixrcfileUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -ilrsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. bash home page: General help using GNU software: /usr/share/bashdb/bashdb-main.inccannot start debugger; debugging mode disabledcannot set uid to %d: effective uid %dcannot set gid to %d: effective gid %d%s: option requires an argument%s: cannot execute binary file                                       P   @timed out waiting for input: auto-logout PROMPT_COMMAND/%s TMOUTreader_loop ; ;|&syntax error near `%s'syntax errorreadline stdinTZ%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEPS0esacdonethenelseelif#%^,~:-=?+/evalletexpected `)'=~-nUse "%s" to leave the shell. "$@"COPROCcommand substitution-p&&||<&>&;;;;&<<-<<<&>&>>>|fiforselectwhileuntil[[coproc++*+**>$@>?$@$@$@$@$@$@$@$@$@$@$@h?h?h?h?h?h?h?h?$@$@$@$@$@$@$@$@X@X@$@$@@$@$@$@XA$@$@$@$@$@$@$@$@$@$@$@X@$@A8C$@$@$@CCC$@$@$@C$@$@X@C$@$@XA$@8B$@XB$@B$@$@$@CBX@>A8CK L OK7sP8r0e%i*bٶQѵdHŴ_wԻF*ּ1eѿ?B@#dսbj8M({,|[:]:K!5abD@(nXZ/H {();&| '()   !  =>>>>??@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAABBCCDDDDDEEEEEEEEEEEFFFFFFFFGGGGHHHHHHIIIJJJKKLMMMMMNNNOPQRRRSSTTTTUUUUUUVVWXXYYYZZZZZZ[[\\\]]^^^_____`````aaabbb ' ~75<=%?><BE 53 !<0E5  D3 ;!"C334;12|}7x9;83!"9;234;933=>993!"339988~333993998;28()*82342342()*#$%&'+,-./<)67#$%&'5+,-./=>67"#$%&')+-../<:5<679::? ::!"#$%&'123+,-./:3467:9;  ::::4#$%&'+,-./234679; #$%&'+,-./3679; #$%&'+,-./679; #$%&'+,-./3679; #$%&'+,-./679;#$%&'+./67@AEw (v)&(85=rs5><wKv F|} d?eyz~LB !f|} !GHIMhiwGH-9bc=gjk?55lm.:no>wpq t  GHI55GHI#$%u,38B4NOPQR7S;<TUAVWCDI  !"*+/10 !6D 2EF JK LM@ 'GHI !  !  !  ! C !XYZ[\]^_`a"#$x%&'()*+,-./0129:{J;346733l3333334333333T3363433345o69;<@JDA>F?EGHI4jf& /)#,23 4:7=hgp("1+%. '!0*$- ne8cbiktUVBCd`m_z|~u]KLWXal{}^MNSTYZqvwsxyQRrOP[\43%339.f6-3G3fh#kPp3333333333333333333f333333333Q~  33333333333333333333333333333333+3D3=3333H33)3333333333333333333333333333333333??333333<33Jl33,.33)3333339333833 333333:33)3LP333WWW3333 33;G*333n3V2W?3+333333333Z333q333333v33333kA33333oE33vM3333331;<827695:  !"#$%&'()*+,-./04syntax error near unexpected token `%s'syntax error: unexpected end of filemaximum here-document count exceededunexpected EOF while looking for matching `%c'unexpected EOF while looking for matching `)'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandOLDPWD`%s': not a valid identifier/dev/ttyPROMPT_DIRTRIM:~getcwd: cannot access parent directories/bin:/usr/bin:/sbin:/usr/sbin:/esyntax error: `;' unexpectedsyntax error: `((%s))'environmentclean_simple_commandsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')make_redirection: redirection instruction `%d' out of range 4 DD 4%u{%s}<<%s%s>| %s<> %s<<< %s{%s}<&%d%d<&%d{%s}>&%d%d>&%d{%s}<&%s%d<&%s{%s}>&%s%d>&%s{%s}<&%d-%d<&%d-{%s}>&%d-%d>&%d-{%s}<&%s-%d<&%s-{%s}>&%s-%d>&%s-{%s}>&-%d>&-&> %s&>> %s! ) && || xtrace_set: NULL file pointerPS4%s=(%s) ''%sfor %s in select %s in case %s in case %s in [[ '' ]] (( )) time -p for (( | if then else function %s () { } { coproc %s print_command do function () cprintf: `%c': invalid format characterxtrace_set: %d: invalid file descriptorxtrace fd (%d) != fileno xtrace fp (%d)print_command: bad connector `%d' >=D$@k=];5Bd %s=%s: circular name referenceIFS%s: %s: cannot open as FILEHISTFILEignorespaceignoredupsignorebotherasedupsOPTERR_=SHLVLshell_initshell-initPPIDLINESBASH_ARGVBASH_ARGC%s: cannot unset: readonly %s60060~/.sh_history~/.bash_historyBASH_FUNC_%%() {SHELLOPTS+ x86_64HOSTTYPEOSTYPEMACHTYPEHOSTNAMEMAILCHECKBASHBASH_VERSIONBASH_VERSINFOBASH_EXECUTION_STRINGIGNOREEOFignoreeofHISTCONTROLHISTIGNOREHISTTIMEFORMATEUIDBASH_XTRACEFDBASH_COMPATFUNCNESTSECONDSBASH_COMMANDBASH_SUBSHELLRANDOMBASHPIDHISTCMDCOMP_WORDBREAKSDIRSTACKGROUPSBASH_CMDSBASH_ALIASESGLOBIGNOREPIPESTATUSCHILD_MAXEXECIGNOREHISTFILESIZEHISTSIZEHOSTFILELANGLC_ALLLC_COLLATELC_CTYPELC_MESSAGESLC_NUMERICLC_TIMEMAILMAILPATHTERMCAPTERMINFOTEXTDOMAINTEXTDOMAINDIRhistchars%s: %s: invalid value for trace file descriptor%s: %s: compatibility value out of range%s: removing nameref attribute%s: nameref variable self references not allowedall_local_variables: no function context at current scope%s: variable may not be assigned valuemake_local_variable: no function context at current scopeshell level (%d) too high, resetting to 1%s: assigning integer to name referencepop_var_context: head of shell_variables not a function contextpop_var_context: no global_variables contextpop_scope: head of shell_variables not a temporary environment scopeerror importing function definition for `%s'/usr/local/sbin:/usr/local/bin:/usr/sbin:/usr/bin:/sbin:/binx0(Xx line %s: (null)last command: %s Aborting...warning: INFORM: %s: %s:%s%d: %s: %s: %dunknown command error%s: unbound variable%s: readonly variablebad command typebad connectorbad jumpbash-maintainers@gnu.org%s[%s]invalid numberinvalid arithmetic basevalue too great for base*/%+-&^|expression expecteddivision by 0bug: bad expassign tokensyntax error in expressionrecursion stack underflowmissing `)'exponent less than 0%s%s%s: %s (error token is "%s")syntax error: invalid arithmetic operatorsyntax error: operand expected`:' expected for conditional expressionattempted assignment to non-variableexpression recursion level exceededidentifier expected after pre-increment or pre-decrement                                      l    T bgp_delete: LOOP: psi (%d) == storage[psi].bucket_nextdeleting stopped job %d with process group %lddescribe_pid: %ld: no such pidwaitchld: turning on WNOHANG to avoid indefinite blockwait_for: No record of process %ldbgp_search: LOOP: psi (%d) == storage[psi].bucket_nextwait: pid %ld is not a child of this shellwait_for_job: job %d is stopped%s: job %d already in backgroundinitialize_job_control: getpgrp failedinitialize_job_control: setpgidcannot set terminal process group (%d)Signal %d[%d]%c |%5ldDoneStoppedStopped(%s)RunningDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusstart_pipeline: pgrp pipe[%d] %ld [%ld: %d (%d)] tcsetattrSIGCHLD trapfork: retrychild setpgid (%ld to %ld)fork%s: job has terminated[%d]%s (wd: %s)no job control in this shelljob-working-directorydeclare -%s %s=%s$($[<(>(?*+!@#%^,~:-=?+/@}#%:-=?+/@}%:=+/%s: bad substitution%s: substring expression < 0%s: parameter null or not setprocess substitution%s: invalid variable nameno match: %sbad substitution: no closing `%s' in %scannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1command substitution: ignored null byte in input%s: cannot assign list to array member$%s: cannot assign in this way%s: invalid variable name for name referencecannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %s%s: invalid indirect expansion4512555p253554553333333333555554P35555555555555555555555555545555555555555555555555555555555 4dde8fdddddddd+fdddddddddddddddddfYou have mail in $_You have new mail in $_The mail in %s has been read invalid signal numberSIGinterrupt traptrap_handler: bad signal %dexit trapdebug traperror trapreturn trapEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselferror reading input file: %scannot reset nodelay mode for fd %dcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dunwind_frame_run: %s: frame not foundunwind_frame_discard: %s: frame not foundtttttttttttt%s: integer expression expectedHpppppHpphpppppppppppppHH`pp8pp(p`8pargument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments4.4%s.%d(%d)-%sreleaseGNU bash, version %s (%s) Copyright (C) 2016 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it.There is NO WARRANTY, to the extent permitted by law.@(#)Bash version 4.4.20(1) release GNU ;|&( ;|&()%s: cannot convert indexed to associative array%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative arrayarray assign'()'bad array subscript%s[%s: %s[%s]: %s%0*dbrace expansion: failed to allocate memory for %d elementsbrace expansion: failed to allocate memory for `%s'brace expansion: cannot allocate memory for %s500%s: cannot create: %s%s%s%sC-xC-e%s %dinput-metasymlink-hook;|&{(` "'$include /etc/hostshostname_completion_fileno closing `%c' in %s \"'@<>=;|&()#$`?*[!:{~completion-ignore-case"'\fc -e viREADLINE_LINEREADLINE_POINTbash_execute_unix_command#comment-begin$@Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordhistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'"$<>()<>;&| _EmptycmD_%s: missing colon separatorFIGNOREfc -e "${VISUAL:-${EDITOR:-$(command -v editor || echo emacs)}}"%s: first non-whitespace character is not `"'fc -e "${VISUAL:-${EDITOR:-$(command -v editor || echo vi)}}"bash_execute_unix_command: cannot find keymap for command/usr/share/localePOSIX"" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %s#: %s:%d msgid %s%s msgstr "" redirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %s%s: cannot assign fd to variablefile descriptor out of range%s: ambiguous redirectsh-thd/dev/tcp/*/*/dev/udp/*/*TCOMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDgen-shell-function-matchesCOMPREPLY_DefaultCmD_completion: function `%s' not foundprogrammable_completion: %s: possible retry loopprogcomp_insert: %s: NULL COMPSPEC%s: cannot allocate %lu bytesxmallocxreallocRead lines from a file into an array variable. A synonym for `mapfile'.Read lines from the standard input into an indexed array variable. Read lines from the standard input into the indexed array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -d delim Use DELIM to terminate lines, instead of newline -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0 -s count Discard the first COUNT lines read -t Remove a trailing DELIM from each line read (default newline) -u fd Read lines from file descriptor FD instead of the standard input -C callback Evaluate CALLBACK each time QUANTUM lines are read -c quantum Specify the number of lines read between each call to CALLBACK Arguments: ARRAY Array variable name to use for file data If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly or not an indexed array.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently being executed. If no OPTIONs are given, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME -D Change options for the "default" command completion -E Change options for the "empty" command completion Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications -D apply the completions and actions as the default for commands without any specific completion defined -E apply the completions and actions to "empty" commands -- completion attempted on a blank line When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. The -D option takes precedence over -E. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input %(fmt)T output the date-time string resulting from using FMT as a format string for strftime(3) The format is re-used as necessary to consume all of the arguments. If there are fewer arguments than the format requires, extra format specifications behave as if a zero value or null string, as appropriate, had been supplied. Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list all shell options with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION". Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: The coproc command returns an exit status of 0.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Wait for job completion and return exit status. Waits for each process identified by an ID, which may be a process ID or a job specification, and reports its termination status. If ID is not given, waits for all currently active child processes, and the return status is zero. If ID is a a job specification, waits for all processes in that job's pipeline. If the -n option is supplied, waits for the next job to terminate and returns its exit status. Exit Status: Returns the status of the last ID; fails if ID is invalid or an invalid option is given.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -k the maximum number of kqueues allocated for this process -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks -P the maximum number of pseudoterminals -T the maximum number of threads Not all options are available on all platforms. If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file' -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If a SIGNAL_SPEC is RETURN, ARG is executed each time a shell function or a script run by the . or source builtins finishes executing. A SIGNAL_SPEC of ERR means to execute ARG each time a command's failure would cause the shell to exit when the -e option is enabled. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators and numeric comparison operators as well. The behavior of test depends on the number of arguments. Read the bash manual page for the complete specification. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. All file operators except -h and -L are acting on the target of a symbolic link, not on the symlink itself, if FILE is a symbolic link. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. -v VAR True if the shell variable VAR is set. -R VAR True if the shell variable VAR is set and is a name reference. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. See the bash manual page bash(1) for the handling of parameters (i.e. missing parameters). Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Suspend shell execution. Suspend the execution of this shell until it receives a SIGCONT signal. Unless forced, login shells cannot be suspended. Options: -f force the suspend, even if the shell is a login shell Exit Status: Returns success unless job control is not enabled or an error occurs.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables or functions, depending on whether or not the -f option is given An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable -n treat each NAME as a name reference and unset the variable itself rather than the variable it references Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not resolve symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG and RETURN traps are inherited by shell functions. -- Assign any remaining arguments to the positional parameters. If there are no remaining arguments, the positional parameters are unset. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line in an interactive shell -i text use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline, but honor a delimiter if fewer than NCHARS characters are read before the delimiter -N nchars return only after reading exactly NCHARS characters, unless EOF is encountered or read times out, ignoring any delimiter -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read within TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns immediately, without trying to read any data, returning success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out (in which case it's greater than 128), a variable assignment error occurs, or an invalid file descriptor is supplied as the argument to -u.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed -L synonym for -l Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Remove jobs from current shell. Removes each JOBSPEC argument from the table of active jobs. Without any JOBSPECs, the shell uses its notion of the current job. Options: -a remove all jobs if JOBSPEC is not supplied -h mark each JOBSPEC so that SIGHUP is not sent to the job if the shell receives a SIGHUP -r remove only running jobs Exit Status: Returns success unless an invalid option or JOBSPEC is given.Display status of jobs. Lists the active jobs. JOBSPEC restricts output to that job. Without options, the status of all active jobs is displayed. Options: -l lists process IDs in addition to the normal information -n lists only processes that have changed status since the last notification -p lists process IDs only -r restrict output to running jobs -s restrict output to stopped jobs If -x is supplied, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader. Exit Status: Returns success unless an invalid option is given or an error occurs. If -x is used, returns the exit status of COMMAND.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at position OFFSET. -a append history lines from this session to the history file -n read all history lines not already read from the history file and append them to the history list -r read the history file and append the contents to the history list -w write the current history to the history file -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if HISTFILE has a value, that is used, else ~/.bash_history. If the HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifiying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME as the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Move jobs to the background. Place the jobs identified by each JOB_SPEC in the background, as if they had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Returns success unless job control is not enabled or an error occurs.Move job to the foreground. Place the job identified by JOB_SPEC in the foreground, making it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Status of command placed in foreground, or failure if an error occurs.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Write arguments to the standard output. Display the ARGs, separated by a single space character and followed by a newline, on the standard output. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits Exit Status: Returns success unless a write error occurs.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, a variable assignment error occurs, or the shell is not executing a function.Set variable values and attributes. A synonym for `declare'. See `help declare'.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -g create global variables when used in a shell function; otherwise ignored -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert NAMEs to lower case on assignment -n make NAME a reference to the variable named by its value -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert NAMEs to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. The `-g' option suppresses this behavior. Exit Status: Returns success unless an invalid option is supplied or a variable assignment error occurs.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Return an unsuccessful result. Exit Status: Always fails.Return a successful result. Exit Status: Always succeeds.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed: resolve symbolic links in DIR after processing instances of `..' -P use the physical directory structure without following symbolic links: resolve symbolic links in DIR before processing instances of `..' -e if the -P option is supplied, and the current working directory cannot be determined successfully, exit with a non-zero status -@ on systems that support it, present a file with extended attributes as a directory containing the file attributes The default is to follow symbolic links, as if `-L' were specified. `..' is processed by removing the immediately previous pathname component back to a slash or the beginning of DIR. Exit Status: Returns 0 if the directory is changed, and if $PWD is set successfully when -P is used; non-zero otherwise.Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin..Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -X List key sequences bound with -x and associated commands in a form that can be reused as input. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions Return success unless a NAME is not an existing alias.Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpsvPSVX] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-aAfFgilnrtux] [-p] [name[=value] ...]typeset [-aAfFgilnrtux] [-p] name[=value] ...local [option] name[=value] ...enable [-a] [-dnps] [-f filename] [name ...]exec [-cl] [-a name] [command [arguments ...]] [redirection ...]fc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ... | pid ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]set [-abefhkmnptuvxBCHP] [-o option-name] [--] [arg ...]unset [-f] [-v] [-n] [name ...]export [-fn] [name[=value] ...] or export -preadonly [-aAf] [name[=value] ...] or readonly -ptrap [-lp] [[arg] signal_spec ...]ulimit [-SHabcdefiklmnpqrstuvxPT] [limit]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }variables - Names and meanings of some shell variablesshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-DE] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compopt [-o|+o option] [-DE] [name ...]mapfile [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [expr]cd [-L|[-P [-e]] [-@]] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocalecho [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]logout [n]fg [job_spec]bg [job_spec ...]help [-dms] [pattern ...]disownlet arg [arg ...]readreturn [n]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [-n] [id ...]time [-p] pipeline{ ... }{ COMMANDS ; }job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptprintfcompgencompoptmapfilereadarray-- alias %s`%s': invalid alias name, line editing not enabledbind_builtinlvpVPsSXf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via "%s"%s`%s': cannot unbindonly meaningful in a `for', `while', or `until' loop--helploop countNULL%s %s %s OLDPWD=chdireLPHOME not setOLDPWD not setCDPATHpvVcommand_builtin%s: usage: %s: numeric argument required%s: not found%s: invalid option nameinvalid octal numberinvalid hex number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtinwrite error: %s`'%s: ambiguous job specSIGJUNKUnknown%2d) %s%s: invalid signal specification`%s': not a pid or valid job specerror setting terminal attributes: %serror getting terminal attributes: %s%s: error retrieving current directory: %s: %s +acfgilnprtuxAF%s %d %s %s: reference variable cannot be an array`%s': invalid variable name for name referencecannot use `-f' to make functions%s: quoted compound array assignment deprecated%s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a functionneEadnpsf:enable %s enable -n %s BASH_LOADABLES_PATH%s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %scannot find %s in shared object %s: %sload function for %s returns failure (%d): not loaded_builtin_unload%s: is a directory%s: not a regular file%s: file is too large_evalfileparse_and_execute toppe_disposeparse_and_executeparse_string topparse_stringevalstring%s: ignoring function definition attemptcla:%s: cannot execute: %s~/.bash_logout/etc/bash.bash_logoutThere are stopped jobs. There are running jobs. exit logout not login shell: use `exit':e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %sfc builtin${FCEDIT:-${EDITOR:-$(command -v editor || echo ed)}}${FCEDIT:-${EDITOR:-$(command -v editor || echo vi)}}currentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command %s: hash table empty %s %s: cannot open: %s%*s%s %s: %s dms%ls%c%s %ls %*s%s - SYNOPSIS%*s%s DESCRIPTIONSEE ALSO%*sbash(1) IMPLEMENTATIONThese shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%s: invalid timestamp%5d%c %s%s cannot use more than one of -anrwno other options allowed with `-x'lpnxrsjobs_builtinahrUnknown error(%ld) - %s%s: arguments must be process or job IDsMAPFILE%s: invalid line count%s: invalid array origin%s: invalid callback quantumd:u:n:O:tC:c:s:empty array variable name%s: not an indexed array%s %d %s%s: invalid file descriptor specification%d: invalid file descriptor: %sinternal error: getting variable namedirectory stack emptydirectory stack index %2d %sno other directory%s: invalid argumentdirstackersa:d:i:n:p:t:u:N:read_builtinread error: %d: %s%s: invalid timeout specificationcan only `return' from a function or sourced scriptoff%-15s %s set %co %s allexportbraceexpandfnv%s: cannot unset%s: not an array variableerrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtracecannot simultaneously unset a function and a variabledeclare -%s %s -%s aAfnp%s: not a function%s: cannot exportshift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s -5-555-5-5-5-5-5-5-5-5-5-5-5y5-5-5-5-5y5y5y5%s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP%s is a special shell builtin (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %shardsoft%s: cannot modify limit: %s`%c': bad commandcore file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile locksu=%s,g=%s,o=%s agourwx -SSpumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG%s: invalid shell option nameautocd-s-ushopt %s %s cdable_varsBASHOPTSpsuoqcdspellcheckhashcheckjobscheckwinsizecmdhistcompat31compat32compat40compat41compat42compat43complete_fullquotedirexpanddirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobasciirangesglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinherit_errexitinteractive_commentslastpipelithistmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathxpg_echoWWWWWWWWWWWXWcannot set and unset shell options simultaneouslymissing hex digit for \xmissing unicode digit for \%cwarning: %s: %s#'-+ 0v:hjlLtz`TbTbTbTb`TbTbTbTbTbTbTbTb````````TbTbTbTbTbTbTb`TbTbTbTbTbaTbTbTbTbTbTbTbTbTbTbTbTbTbTbTb4aTbTbTbTbTbTbaTbTbTbTbaaaTbabTbTbTbTbTbTbTbbTbTbTb$bTb4b4aDbTbD`UsttttttttttttttttttttttttrtttrrrttttttttttttttttGqttttttttr'prrrrrtrttttsGqtotntGqttGq`%c': invalid time format specification`%c': invalid format character`%s': missing format character%s: illegal option -- %c %s: option requires an argument -- %c bashdefaultcomplete -o %s dirnamesfilenamesnospaceplusdirs-a-b-d-f-g-j-k-varrayvar-A %s bindinghelptopicrunningsetoptsignalstopped-G%s %s -W-P-X-C-F-E-D-r%s: invalid action namecompopt +o %s +o:DEnoquotenosortgroupserviceuser%s: no completion specificationabcdefgjko:prsuvA:G:W:P:S:X:F:C:DEwarning: -F option may not work as you expectwarning: -C option may not work as you expectnot currently executing completion function |dL4ԑđtdTD ܐ̐<<<, ```````` ``````````````````` ``````````````````````````P0alnum?*+@!asciiwordNULSOHSTXETXEOTENQACKalertBSHTtabLFVTFFCRSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4FSIS3GSIS2RSIS1USspacecommahyphenminusdashperiodslashzeroonetwothreefourfivesixseveneightninecolontildeDELascii?*+@!alnumalphablankcntrlgraphlowerpunctupperxdigitNULSOHSTXETXEOTENQalertBSbackspaceHTLFVTvertical-tabFFform-feedCRcarriage-returnSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBESCIS4IS3GSIS2IS1exclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusdashperiodfull-stopzerotwothreefourfiveseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketDEL<((((((((!!(((((((((((((((((((EEyy\?& }`DTyeeeeeeeeeeeeeeeeeeeeeeeeeeeeebackspacenewlinevertical-tabform-feedcarriage-returnexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signhyphen-minusfull-stopsemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscoregrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-bracketH@FFFFFFFF`@FFFFFFFFFFFFFFFFFFF@@FFFFFFFFFFFFFFFFFFFFFFFFFFpBASH_REMATCH/dev/fd//dev/stderr%s: bad network path specificationsocketconnect%ldm%d.%03dssh_makepathsh_realpathTMPDIR/var/tmp/usr/tmpshtmp%s/%s.XXXXXXw+''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''''@'****@'********)`'`'`'`'`'`'`'*******@'*****'***************'******0&****X()(*')*******h(*** &*x('(*p&+,D,4,$,|+,T,T,T,T,T,T,T,T,T,T,T,T,T,+T,T,T,T,T,T,T,T,T,T,T,+T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,T,+%s/cur%s/tmp%s/new%s/%s%s/invalid base0123456789abcdef0123456789ABCDEF'd \u%04X\u%08XUTF-8ASCIIOAOBOCODOHOF[200~5.1 l|h^0bBFT` l|hwW^0bBFT` l|h^0%bBFT`_*\AaIiCcDdPpYyRrSsXx~ hl^$0ftFT;,%wbeWBE|`vidomove_dispatch: unknown operator %daccept-lineabortarrow-key-prefixbackward-bytebackward-charbackward-kill-linebeginning-of-historybeginning-of-linebracketed-paste-begincall-last-kbd-macrocapitalize-wordcharacter-searchcharacter-search-backwardclear-screencopy-backward-wordcopy-forward-wordcopy-region-as-killdelete-char-or-listdelete-horizontal-spacedigit-argumentdo-lowercase-versiondowncase-worddump-functionsdump-macrosdump-variablesemacs-editing-modeend-kbd-macroend-of-historyend-of-lineexchange-point-and-markforward-backward-delete-charforward-byteforward-charforward-search-historyhistory-search-backwardhistory-search-forwardinsert-commentinsert-completionskill-whole-linekill-regionmenu-complete-backwardnext-historyold-menu-completeoverwrite-modepossible-completionsprevious-historyprint-last-kbd-macroquoted-insertre-read-init-fileredraw-current-linereverse-search-historyrevert-lineself-insertskip-csi-sequencestart-kbd-macrotab-inserttranspose-charstranspose-wordstty-statusundouniversal-argumentunix-filename-ruboutunix-line-discardupcase-wordyankyank-last-argyank-nth-argvi-append-eolvi-append-modevi-arg-digitvi-back-to-indentvi-backward-bigwordvi-backward-wordvi-bWordvi-bwordvi-change-casevi-change-charvi-change-tovi-char-searchvi-columnvi-completevi-deletevi-delete-tovi-eWordvi-editing-modevi-end-bigwordvi-end-wordvi-eof-maybevi-ewordvi-fWordvi-fetch-historyvi-first-printvi-forward-bigwordvi-forward-wordvi-fwordvi-goto-markvi-insert-begvi-insertion-modevi-matchvi-movement-modevi-next-wordvi-overstrikevi-overstrike-deletevi-prev-wordvi-putvi-redovi-replacevi-ruboutvi-searchvi-search-againvi-set-markvi-substvi-tilde-expandvi-unix-word-ruboutvi-yank-argvi-yank-popvi-yank-tohistory-substring-search-backwardhistory-substring-search-forwardnon-incremental-forward-search-historynon-incremental-reverse-search-historynon-incremental-forward-search-history-againnon-incremental-reverse-search-history-againwarning: turning off output flushing[?2004l[?2004h//--More-- "\'`@$><=;|&{(Display all %d possibilities? (y or n)bad value %d for what_to_do in rl_completereadline: $endif without matching $ifnoneaudiblevisibleterm=mode=C-\M-"%s%s": "%s" %s%s outputs %s emacs-standard(ins)(cmd)bell-stylecompletion-display-widthcompletion-query-itemshistory-sizeisearch-terminatorskeymapkeyseq-timeoutemacs-mode-stringvi-cmd-mode-stringvi-ins-mode-stringbind-tty-special-charsblink-matching-parenprefer-visible-bellshow-mode-in-prompt%s: unknown variable nameControl-Meta%s: unknown parser directive%s: unknown key modifierprefix-meta/etc/inputrcINPUTRC~/.inputrc\C-%c# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on ... set %s %s %s is set to `%s' emacs-metaemacs-ctlxvi-movevi-commandvi-insertEscapeLFDNewlineRETReturnRuboutSPCSpaceTabbyte-orientedcolored-completion-prefixcolored-statscompletion-map-caseconvert-metadisable-completionecho-control-charactersenable-bracketed-pasteenable-keypadenable-meta-keyexpand-tildehistory-preserve-pointhorizontal-scroll-modemark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmenu-complete-display-prefixmeta-flagoutput-metapage-completionsrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedskip-completed-textvisible-statsendifincludeotherC-CTRL-$else found without matching $ifcompletion-prefix-display-length%s: no closing `"' in key binding%s: no key sequence terminatorprint-completions-horizontally(@Xp > 4 *  H  544`42g6\%o/-_=~.#$[201~readline_callback_read_char() called with no handler!coli@7 amxnkmDCclcrdceiimkDkHkIkdkhklkrkummmopcvbvsutf8(arg: %d) X%luevent not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitution() <>;&|$!@?+*"'`^$*%-:$*%^ ;&()|<> =8++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++++8++q8+++++++\88:887+++7 ~ ~targetjxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkjjjjjjjjxkxkxkxkxkxkxklxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkxkkxkxkxkxkxkxkplxk`lPlxkxk@llxkxkxkxkxkxkxklxkxkxklxklxkpkxkklcLS_COLORSLS_COLORS: syntax error: %s[01;3401;3601;3501;3301;3237;4130;4337;4434;4230;4230;41nodilnpisobdmisusgtwcamhLS_COLORS: unrecognized prefix: %sunparsable value for LS_COLORS environment variable;BU7CE(C E@CEC9FCPG(DGDVIfIfcJfK@hNkzatlbmdmhx,ijlآopPaq-uOuuHv| w|EBXCВDDdD`|DDpDEE0EpPE0EPEEЗE F0F lF`FFFFFpG$G0?P?@ATABBЀ CC$GpHIpL4L\M|0MMM N8PRăT UU@VpVPWW̄YYY< Z\`ZxZ0[[؅[P\$\@]X]p]^^܆_`Tde0fP`fpfftuv<0vPw@xxȉzz4 {T@{h{|p|0}(}`}tċp 8\@Ȍ$Hl@p$@Ў\@@<`М< pHtԑ@ 0PDppб ȒDhpP<t`ȔP|0P@4`pĖp Dp0З0T`h 0@,hș`$@P`dxК X`ԛ 40\ 0̜ @lP8 t`h0 ؟ ! !,!H!`0"`""#Ƞ#ܠ@#`## $H)@*$0pp4`55<\>BDD MQQQR@SS\@a<eiܧo,qqrĨrv4PwXw@xxȩypy{\P}}Ъ~PTpЫd@Ь@`ح 0p Ќ<P@4Lpp04Pd `̰@08 IJ ` Dxpس0,dдp@ H!$,@%`% 101@1 P1 p1<1T1hP2P340 5d05x6ĸ7ظ07`88`9@:;d ;;ȺP<0>8>T>l0???̻A0ApDhDE̼`G@J$pJ8Kl@KKMPPD`QQQ Rܾ@R`RRS0TxU U@U`UȿUܿUUV<VtVXXYPZZ \P\\\ ]80]L@]`]^ ^@^`^^^^^(0_<_X@ab cPccdPdp0effg$0g8g`hPiij0jj,llmnnn80oTpopoo0ppPq<@r|s@t`y({t{{|@~<~h~|~ (@Tp pp $H`@(<(`d` @0p(@ph0pО40Xp@0<lpP(TPpp0 `4HdPp0h4pP|0PD 4`l(TPp$L$p Hpp<t0<Pd@Dp0P`<@4p0 @ 4@Lpd < @P(H\p`@dp` |@`@ !P@!xp$`%'X@(((( )0))H)\**p**`+(p+<-P-....4/L /d1`44@7`7x7`88099 ;,`;@?`MO$pUpU VVW PXhZ[p[[0[PP\|\]`]]0^4_pggggPhh0hHPitl@xyd0zpzz ||$|8|L }`P}x} ~~HP pd@@<T`P TtВ0 (Pt 0@@М 0`pp<@l@кp80d`0DplP<t @` 80L`xP8DX l`  8Lx0p8X0p |p@ 8 \   p  0P `  p\   0 @ 0 D X   p     $ 0 @ ` \  x        X t@   `(@@PT`h|PP$8ph0 P P3`33@7 @p AIPII0IDI`Jt J@LLMpM(TpPVPWW[0[HP]h]^^`k`@m0nn o oLsuv(v\Pw| P\P`H` p0PPlЧ0< x0`0 4 0 (Pd0x 0 X   $! X!t!! ! "`4"x"@"""P#P#`#p#P$$$$$p$(%`%p%p&P&&0' P' l' 'P((p((0)D)`)x)@))))  *4*`***`**<+P +!+$`,$,%,&,`)$-)L-0+|-+-,-P-.-,. .X..t.2. J/L/M/M 0 M 0pM80MP0R0@R0R0YD1YX1`Z1Z1_X2Pa2Pe20i3pl3m3m3m3pn3pq04rl4t4v4 w 5P555Ћ505 \6 6607БH7`78P8`8 9X9 l909P9`99P,: :p:;(;x;;`<<<P<<=`4=P=h=|=@=== =0>l>>>>>>? ,?0@?X?p??@??? ?@? @ @ 4@P@d@x@@@@@(A`\AApAAA Bp0BDBXBBBC0hC C CC@8DpD0DDD EP(EhEEF0dFFF F(G@GTG0pG@GPG`GpGGGHlH`HHIhIPII0J(J@PJpJ Jp J 4K HK `KK0K0LpL0L (M`M#M0$Mp% N0&PN@&hN'N)N *Np*O2XO`3Op3O3O3OP4O4 PP6 P64P@9hP :P:P;@QxR>R?R @SPA$SB\S`CSCSCSCSCS0DS`JxTpJTLT`MUM(UPOlU`RURU TUPUUUVV0V`VPVVdVWV WVpWVWVXV@XWX0W`Y|WZWZWZW]X0^PX`^dX^xX^X^X0_Xp_X a Y0a Ypa@YatY bYpbYbYcZdZe(Z ghZiZpiZiZkH[kl[l[ m[pm[m[m[m\0n,\oP\pol\o\@p\p\p\`sH]s|]u]u]0v(^w\^0y^z^`{^~8_~__ _8`P`d``Јa0(aTa paPaaa@ab$bXbpbbpbbbcBBD A(J (A ABBH  X Dc I 8 FAyLT rBBE B(D0A8J 8A0A(B BBBG 0Aw H s E @ ]AAD  AAI ^ AAH RAA0 BAD G0  AABD @DWTh,D0 A ##,lBAF W ABE 0(TQAI d AAG DFA4TAAJ i AAI h CAD 4HAAD Z CAD M CAG <$AAO P CAK x DAK DEAt9AW H Xv8BAD m ABA S ABB $0?A^ A K M FXDT$p<AAF oCA`KV O o0BAD JA  AABJ @BBB A(D0F@ 0A(A BBBH 0FD9Aw`&Ad|RGE A LeGX A 'AM B VFV8DT@>aX0d3FXJ,LBDH B ABE 0|{BAA G0|  AABE <$ZAAI Q DAG P DAK DFA@DJAJ T DAJ @AAFH $4iAW AAL\x*BBD A(G0 (D ABBC p (D ABBG ,X.AG  AD C AD (XlAAG G DAK $}WqHPF J 00jAD D0b  AABG (diG b AE S AD 0TAAJ m DAB }DA4]BBD A(N0(A ABBAD| Qt\0,X aAAG b DAH cDAH` BBBE B(D0A8P` 8A0A(B BBBG !AO !RAD F AA $!YAG k AD _A"3K`$04"7AAN dAA4XL"`BBD A(O0A(A ABB8t"iBBE A(D0S(A BBB8"iBBE A(D0S(A BBBd"BBE B(H0A8I`e 8A0A(B BBBD  8C0A(B BBBH $pD%JAAL yAA4l%BBD A(O0`(A ABB(%NBAD CAB4%fBBD A(O0G(A ABB4&H &$\&VAAL EAA4@&JBBD A(R0h(A ABBX&6At|&UAS@&AAG0V DAD ^ DAE _ DAD d8,'BBB B(A0A8Dp 8A0A(B BBBI  8G0A(B BBBQ @)}BBE A(F0L@ 0A(A BBBE <*#BBE A(D0 (A BBBC $$+PAAL AA(L+oBAD dABx,A^ A a8,AAD ] AAK \ DAG ,* -rD~ F iHl-BBB B(A0A8G 8A0A(B BBBD ,T/RGHD vABD0}Gf K `020:Ab E M40AAG B CAI Q DAJ ,T1.BAD  LBB @T2vAAD K CAK O CAM d JAI Y CAK h CAL < AAJ D JAI K CAI @P6kAAN  JAL y AAE ZCA`|7{UBD A(S0 (D ABBG [ (A ABBG HB0l8G A ,L9RGHD vABD@|9DAD W ABE d ABQ [AB::SDy C ,X:H@d:BBI B(A0A8DpQ 8A0A(B BBBH 0A|L0BBA A(D0j (D ABBC K (A DBBD $1=T81 MBB B(A0A8D 8A0A(B BBBA 1t%1:Ma1$1AAG DA1,H 2(-BBB B(A0A8G` 8A0A(B BBBB X2 %TP,p2$jGAA XABD$2dL`\~ J 02ܨHv R pHA G A2HRF@J3,3D g E $H3$_BAD I ABE H@>TBBE B(D0A8GP 8D0A(B BBBG 8>bBBA A(G0 (D ABBG 8><UBA A(G0(D ABBH?BBB B(D0A8D@m 8D0A(B BBBE $P?4JAAF |DAx?\=AZ E \?|&H]H?RBBD A(L0N (A ABBG [(A ABB@(H_4@_AAJ [ AAG ] AAI dT@BBB B(A0A8D` 8A0A(B BBBL 4 8A0A(B BBBJ @HAM0f AK (@AAK  AAB AtAD0h AA (0A{AAN@c AAA ,\AXBAD  ABD AVAW0w AA ATYAW H ATD0^ N 8AIAA  KBG  KBJ $B8B3AW H RXB!DM G DxB8Ar B]AG s AD BnAJ E TBlHHxB 4CAAD n DAG W FAJ @C$oN`\Cx4D ktCsgGC-DaC Hdc8CXBBD A(N0x (D ABBH (CAAM0 AAF H$DHBB D(A0d (F BBBG q(A BBBdpD$uBBB B(D0A8DPE 8F0A(B BBBK  8C0A(B BBBC pD<KBD A(G0 (C ABBE  (C ABBJ D (F ABBA PF0LEMH^ J NlEHAW B mE0HV B KE,HX H CLEBBE B(A0A8FX 8A0A(B BBBK FH8FBUS H DXF"4lF{AAG  AAL W DAL F Ab M @ H FGKk J HF BBB B(D0A8M` 8A0A(B BBBF 0G7K] H FPG2Ah G ApG8GBAD ] ABI P ABE G4AR4G8cBGA { ABP GAB,HpBAA  ABF 4DHSFAI g FAJ DAAB|H(LH4@BBB A(A0f (D BBBH Q (A BBBH (H$wBAD lAB IxAT((I|bBAD WAB TIDf F H H N(xI,AF a HP THIRAJ I AJ AA I%A]JAJ JAJ AA @JtAJ AA dJ`AJ AA (JLAAJ AAA TJ ,BBE A(D0GPSAw 0A(A BBBB  KFAAS ,K(&@KD,H]\KX%A_xKl%A_KaK(KlHAA lKB(KBBE A(A0LT1AZ E 8LxBBD A(RP (A ABBA LXL BBB B(A0A8D 8A0A(B BBBA L oAx G f J LL BBB A(A0\ (A BBBE  (A BBBH M0Dk 4MDJ B F J HXM|BBB B(A0A8D`\ 8D0A(B BBBI MA] B I A HM\BBB B(K0A8D@a 8D0A(B BBBJ $NjAAD ^DA$`}@DEB A(A0 (A BBBG a (A BBBH X (A BBBA ~+DfH ~BEA A(F0} (A ABBF U (H ABBF ,l~(TAD0H AB  AD ~X0~T.BAA F0x  AABJ ~P!~l0Q^/((hBHH w ABD T hܚ |ؚKp E E K dplx,DCXbD]Dt@HAA } ABF A DBI r ABK 4AAG O FAA X AAF 6,)H780tBBC A(O (A ABBD lX'DS I F(hBFAG lAADHZBBD B(A0A8DP 8A0A(B BBBH FJ RCo N Q@$T^Pf J QFF,|(7LAA \ ABC 8ztb J T,̂IAAI U GAX fAG } AJ  4\HBBK A(N0 (A ABBI  (K ABBL V(D ABB %D`$#Aa<܃8BBB A(A0 (A BBBG 2K\I8A\T2K\Ipԧ2K^GJMtG,$(YAAD PAA4`rBBD D(F0Y(A ABB8TAA F CBG IFBG<X BBB A(D0 (A BBBG HBBI B(D0A8GPy 8A0A(B BBBB  BH\ BBB B(A0A8I` 8A0A(B BBBF HD0BBH B(H0A8Qp 8A0A(B BBBF 4AAK i DAE P DAK Ȇ܆d$1BBB B(A0A8GP 8A0A(B BBBK ? 8A0A(B BBBG (XLAd K K E K  LMBBB B(A0A8N  8A0A(B BBBB 0$BAA G{  AABF Dе~Dy\8MpDGn K (u0BAA I  AABC Ԉ D I |V~D(\!KU @tDb J E K d@H|H\BBE B(D0A8I 8A0A(B BBBF ȉ\&D܉e"A8`CBBD A(IPI (A ABBG 0t!MD+lXAT K | T i G x H _ A r V Q W q G A W A W J V A W A W A W q ȊAG AG AD A AI SsOq E d0DO] D drO4W A  E R A Z A A E ZAk D ԋTAk D DPD e A $ @K[ B(G0PD@-\P$\XH} K e K AX" *TǓ83PT D FX3NR H F@ x]JAD j ABD  ABJ QAB P[M} F FAtJWgH A F4Af I CL̍BBB B(A0A8Gpb 8A0A(B BBBC 8(ZNBD A(J0l(A ABBG,XLcWAD xABI,cWAD xABI,cWAD xABI, cWAD xABI(L[VAG mDAH(DZBAD OABp>A|,EAA l ABJ 88BBD A(J0_ (A DBBE @BAD s ABC I AXF AJB<$P$#d@"FU4TFAG K AAE ZAADAUԐ,Ufy A g I pF |,KBE A(D0o (F BBBF u (A BBBD J (A BBBG k (A BBBF C(4ԑprEAA O ABO FAB( UEAA { ABK H8BBA A(D0i (F ABBJ G(D ABB(@>EDA pABLTEBB A(A0 (A BBBD D (D BBBJ L@BBB B(A0A8Do 8A0A(B BBBI HPBBB B(A0A8D` 8D0A(B BBBB 0BAA D0s  AABA HГT~BBB B(A0A8DP 8A0A(B BBBG L~BBB B(A0A8DP 8A0A(B BBBB (l~BAA vAB( BAA AB\ĔLBE B(D0A8RP8D0A(B BBBFPP8$@zBBD A(J0w (D ABBE L`BBE A(D0m (A BBBF Y (A BBBH  ĕZ` VpܕXBBD A(G0o (D ABBH V (D ABBI J (D ABBE D (D ABBK 4PjBBD A(I0N(D ABBHBBE B(A0A8Jf 8A0A(B BBBI 4ԖPxBAD r ABL OAB4 xBAD r ABL OAB(DAAL e AAK 8pTBBD A(J@ (A ABBA HyBBE B(A0A8GpM 8A0A(B BBBE (,>BAD sAB$@DN$@DHACL0uAAphl;BBC A(J0 (D ABBE _ (D ABBH X (D ABBG o (D ABBH `ܘ8BBB B(D0A8O@Q 8A0A(B BBBA L 8C0A(B BBBH H@BBE B(D0A8Gp 8A0A(B BBBG (h4AAD d DAA H|SBBE B(D0A8Ip 8A0A(B BBBD 4, BAC D@  AABB \dpBBB B(A0A8D@m 8F0A(B BBBE G8D0A(B BBBĚAN8pBBE A(A0Z(D BBB8pBBE A(A0Z(D BBB4X,`BBD A(D0I(D ABBT`,\sBAD a ABA ,lBAD X ABF :Dk I A8 CLZ J FX<lH<T|NBE A(D0T(D BBBA<|NBE A(D0T(D BBBAHBBB B(A0A8DPR 8D0A(B BBBC H`BBB B(A0A8Dp 8A0A(B BBBE #HԝfBBB B(A0A8DP  8D0A(B BBBA H $BBB B(A0A8D`  8A0A(B BBBE LlBBB B(A0A8D` 8A0A(B BBBJ L( BBD B(D0A8K 8A0A(B BBBE H BBB B(A0A8Dp 8A0A(B BBBA HXoBBE B(A0A8G 8A0A(B BBBG @dLjBE B(D0A8M> 8D0A(B BBBH L, BAD Y ABE 8P!IGI H(H0j(A BBBh!O8!nBBA A(I@ (A ABBH ܠ"2#20#<#LRu0t#A` G UP#DSh#'Db$nAb E E(T$AAGG AAF ,̡8%KK VCAH ` AG X%HBB A(A08K@@8A0K (A BBBH d (A BBBM `Xl'jBBE B(D0A8DP 8A0A(B BBBK  8F0A(B BBBG x)tQ8Ԣ *(BBA A(I@ (A ABBG ,0DX D O0$, D ,$A[ D Cd0,Dxl,4h,AAI O AAD ^ AAH Hģ-BBE B(D0A8G`G 8A0A(B BBBH H.BBB B(D0A8GP^ 8D0A(B BBBA \1AD P AJ D1BBE A(F0MC 0A(A BBBH Ȥ,34ܤ83jBAD K ABK AFBdp3tBBB B(D0A8G`n 8D0A(B BBBI  8A0A(B BBBG |5-Ak5KK5KK(ȥ5AAJt AAF @`6{BBG A(D0D@ 0C(A BBBI 087JAAJ b GAJ DDA$l7+AAF ^CA@7+BAA D02  DABG i  DABH Dئ:BBI B(A0A8K@8A0A(B BBBP T;FDBB A(A0W (C BBBF  (A BBBI ,tP=IHA ^ ABE (=QBOH tABЧ==(=QBOH tAB$>(8 >QBOH tABd@>(x<>QBOH tABp>(l>QBHH {AB>H>HII C(H0 (A BBBE `(A BBBD0? LX,?BBB A(A0f (A HBBE 3 (A HBBA l@EH|@ĩ@.BAD m EBE c ABJ qABAKI AKI8AKIPAKIhAKI@ABAA D0!  DABH m  AABG LĪPCSBBI B(A0A8G 8A0A(B BBBA `FRKg F H0FzBBB B(A0A8DP 8D0A(B BBBE |H>DyIYA@DIxD@ D ̫IKPpItHgDJDDo E (xJAAL  AAA HK4H\L~BBG B(D0A8DPC 8D0A(B BBBJ HLP{ BBB B(D0A8Gp 8A0A(B BBBC H]BBBB B(A0A8D`M 8A0A(B BBBK H@_BBB B(A0A8DpG 8A0A(B BBBA d.0euAAI0a FAM hGA0ԭ`eZAAK d AAE UGAeHM K PX(eIBBA A(D0 (C ABBC a (F ABBD P(C ABB8f5BBA A(G (A ABBD 4hqBAD B ABT MAB0,iYAAD x CAF IFA,Xi7D_ E NLxi7D_ E N(liVBAA y ABH iTEa J WI jWEg D _A0DjNAAG i CAJ DDA`jDD[ I 0jD| H vPPjDHA _ ABA Z ABC r ABK \ ABA 00lBAA D0t  AABH ذs ss sD C 04tXALxt-\P(dtbKAD LAAB@tMBBE A(D0J@ 0A(A BBBE HԱw BBB B(A0A8Pp 8A0A(B BBBA \ 46DBB A(A0 (A BBBE d (G BBBE F(C BBBC F H;Є+Ai@вvBBB A(A0G@ 0A(A BBBD ( HAD ~ ABB @tT#h"|#4І}BAD H ABF \FB̳MAk D XHHBBD A(D0G (C ABBD c(F CBB(82BAF eAB`dBBE B(D0A8G 8D0A(B BBBE 8G0A(B BBBHȴ,fBBB B(D0A8F`, 8D0A(B BBBD PK(@<PBH A(M0Q (A ABBA `bAZ XYA J a[UfMܵ؎D D vHG I C E 8-BAD  ABF  ABH X>Kn8p$BBD A(P0x (D ABBF Ȕ%(AAD  AAD LȕBED B(A0A8R` 8A0A(B BBBD 0<(dAAD H CAF DFApd?DS I ^ (AATz AAF 0зQAAI m GAH DCA<@BBK D(D0 (D BBBH HD%BBB B(D0A8Mx 8A0A(B BBBD 0ԛ`AAP m GAI DFAĸ$AbDIDN$ $ `8BBB B(D0A8NP 8D0A(B BBBE w 8G0A(B BBBI HBBB B(A0A8G\ 8A0A(B BBBI ?Dzd BBG B(D0A8FP, 8A0A(B BBBB  8C0A(B BBBE |Ȣ7Ag H F8HBBA A(T (A ABBG ,غBAA  ABI L|rBBA A(I0 (A ABBA i (D ABBN ,XPAC HDe K 0̺yAAI0O CAB VAAzԻA H A J pA J 4Ar E (TPAAG x CAK `Ľ(BBB B(A0A8DP 8F0A(B BBBH Q 8C0A(B BBBK (=BAD rAB$5AAI gAA$8CAAI uAA$`7AAI iAA$7AAI iAA[AYH̽XvBBE B(D0A8Tp 8A0A(B BBBI <BBE A(D0 (A BBBK 4X AAI n CAK H CAL `dBBD B(A0A8D` 8A0A(B BBBK P 8A0A(B BBBF  DY (DV$0DV<8DVDT@BBH B(A0A8FP8C0A(B BBB Ŀ\ؿKBE B(D0A8DP-8D0A(B BBBAPP8LAQ(haAAG n AAG HBBB B(A0A8JP 8D0A(B BBBE $\KBB B(D0A8D@8D0A(B BBBGP@LT`XBBB A(D0 (D BBBE =(D BBBlpr BBB B(D0A8RHYBSdXB 8A0A(B BBBC HBBB B(D0A8JP 8D0A(B BBBJ `DBt>BBE B(D0A8LFBaB_EZBjB]A 8A0A(B BBBA  }Aw(L<XiDdT(hBAD AB0*TUHT"p4PT_RvHHD EDA A ABB O ABF j ABK T3PT D Ft+0QAAG Q DAA kDA0iAAG V DAD {DA ( (}BAD gAB\8|BBA A(I@J (A ABBA I (F ABBD  (C ABBK 8BAH t ABF F FBJ dBBB B(D0A8Dp 8F0A(B BBBG  8C0A(B BBBK <Lk` TPAG G AH x,AG G AH 4gAAD w AAI I AAE D@gBBB A(A0G@ 0A(A BBBI h)Ac08|AAN h CAD DHALl,BBD A(F0 (C ABBE  (C ABBI l2BBE A(D0D@ 0A(A BBBC I 0C(A BBBE | 0F(A BBBG H,BBB B(A0A8D` 8A0A(B BBBB Hx HDA  ABA V FBB n CBE plLhBBD A(I@I (A ABBG I (F ABBD <A~ A A _ ` tAJ AA Mj0K 8 AJ AA $AF Q KDAp G K$%A_@%A_\%A_x%A_%A_$%A_8Ak L %A_%A_ %A_4<AAG d GAK \ GAL t`%A_tNDa K TNDa K T%A_1Ak VAq N $PGi H D"D]\p JH,BBE B(A0A8N@ 8A0A(B BBBH 4AAI U FAI | CAA HAD V AD @$F4T`HAD S ABM {CB(:AqHLBBB B(G0A8F 8D0A(B BBBF @FA I hHN J [ E G A G I FH8BBB B(A0A8DP 8A0A(B BBBH HPBBB B(A0A8DPz 8D0A(B BBBK $D[ A ,D^ F 7Da K F( <( BBB B(D0A8N 8A0A(B BBBE O 8A0A(B BBBG  8C0A(B BBBE   BU_L BBB B(A0A8G`  8A0A(B BBBI L<$ BBB B(D0A8NpJ 8D0A(B BBBF X-JDm O IL-BBB B(D0A8G 8A0A(B BBBI $(5:AAH kCA$$@5;AAH lCALX5 `T5BJw|5 5A\85BBD A(I0a (A ABBG l7{uQ A p7Gbd$8VDa K aDD@8BBB A(D0J' 0A(A BBBD (>=AAL AAA @D@[ A $A3AAG dDALABBB B(D0A8L@Z 8C0A(B BBBA LXEZ{ZdEWGG A FDT H b F \GDj J f B G HGBBB B(A0A8D@ 8C0A(B BBBB L,I BBE B(D0A8Qp 8A0A(B BBBA 8|(TBBD A(J (A ABBD $UDl H P H y G @dVEDA _ ABD O ABF pAB$V(Dc(<VkBAF \CBHhBBB B(A0A8Gp$ 8A0A(B BBBA PBBB B(A0A8Q 8A0A(B BBBD DTBDPA|DXAKDPBDUBlDKAg DI ~DPAHBBB B(A0A8DP  8C0A(B BBBK % (<JDET05HlX^BBD B(D0A8DP 8C0A(B BBBG l!,H!pBII D(A0w (C BBBG F(C BBBD!BAD  CBF E CBF CB`d( 0t`(AAD r CAL FCA0({AAD b CAD FCA)BBI B(D0A8Sp 8A0A(B BBBH  8F0A(B BBBH e 8F0A(B BBBD Y 8C0D(B BBBA @t,BAAS  DAF  HAO dHA@.BBB A(A0D` 0A(A BBBF 8h2BBA A(D`: (A ABBF h8 6;BBI B(D0A8J` 8A0A(B BBBE  8C0A(B BBBE 8l9v9X$:|G\ E L:BBE B(D0A8J: 8A0A(B BBBB 8L8=BBA A(GP (A ABBD @>BBE A(D0JP 0A(A BBBE H?BBB B(D0A8JPw 8C0A(B BBBF  AAG0 AC ,<A AC HK E LlKt BBB B(A0A8Lp 8D0A(B BBBJ UU0V]AAJ v AAD NEA\,VBBB B(E0A8DP 8A0A(B BBBE ]8F0A(B BBB\xVBBF B(A0A8DP 8A0A(B BBBK ^8F0A(B BBB\WS@WVDD R ABE L CBG  00YTDW AH M AJ LdZBBB B(D0A8G< 8A0A(B BBBF |i^BBE B(D0A8Qc 8F0A(B BBBA  8A0A(B BBBA { 8A0D(B BBBK 44nGBBD A(M0U(R ABBLlnKBBB B(A0A8GG 8A0A(B BBBF |KBBE B(C0A8P^ 8F0A(B BBBA  8A0A(B BBBA w 8A0D(B BBBG 4<FBBD A(M0T(R ABBt  44BAD MPT  AABD HBBE B(D0A8Gp 8A0A(B BBBK PHBBB B(A0A8D 8A0A(B BBBB LEBBA A(D0W (A ABBI  (A ABBF @hXDs AH F AA  AG H0Ď*LDBBA A(D0` (A ABBH U (A ABBE @YD{ AG F AI  AG HP̑EBB A(A0_ (D BBBD \ (D BBBB l,HDBBB A(A0D@` 0D(A BBBI D 0F(A BBBG e 0D(A BBBH (0$AAD \ CAJ OFA,yEAA C ABC Г:Ab E Q4ATX D P$*TUl8@ LdAQ0K AA KD0A A ̔$ؔgAT0K AA 4 nBBD A(J0Q(D ABB8LXHBEE D(A0l(D BBBlhOt E |ؕOt E |HOi H L ĖPDm G W4H \B[ft L[pX40:̗D`t H @< HD`~ F (̘<ؘPD` A lhdpD`~ F 0:<D`t H LBBE B(D0A8M 8A0A(B BBBB 0DpAAD0c FAH FA xALJ AH hwD@m A DȞBBB A(A0G 0A(A BBBF Hܠ5,FA) F L8}`LtPLBBE B(D0A8GP 8A0A(B BBBH PuAJc AA HBBD B(D0A8G` 8D0A(B BBBF L4BBB B(A0A8JAy 8A0A(B BBBI <EAA  ABC r ABK pD[ A O A ,LtBAD W ABG 8BBD A(O@W (A ABBK 4TdAAF s DAH K DAH (8rAAK e DAI 4wFAI I DAB GDADԯ*NSG "FT(6aT<D EBB A(A0 (D BBBD HBBB B(D0A8DP 8A0D(B BBBF `BBB B(D0A8GPU 8D0A(B BBBJ I 8D0A(B BBBJ H4QBBE B(A0A8D` 8D0A(B BBBG 8ĴjNBH A(N0s(A ABBH,BNDD fABA"@4BBB A(D0DP{ 0A(A BBBF D\ p$Ab    #ĵ "FLd ԵMBB B(A0A8D@t 8A0A(B BBBI D8C0A(B BBBH8,BBD A(D0 (D ABBK 4DܶBBD B(D0A8JP8D0A(B BBB` BBB B(A0A8D@ 8F0A(B BBBJ G8D0A(B BBBL0BBB B(A0A8JA 8A0A(B BBBC ,TAAG v DAD |Ab E S$ uAb E L$DAAP uAAljAO H H89BBE B(D0A8G 8A0A(B BBBG ,qAb E TFAI V FAK ZAADH D IAR DFAPԿad0cH|BBB B(A0A8Dp 8D0A(B BBBH H jBBB B(A0A8D` 8A0A(B BBBD 4 0BAC k ABD ICBXL BBA A(D0f (D ABBG D (D DBBH D(F ABBH BBE B(G0D8O@Y 8D0A(B BBBE L PBBE B(A0A8US 8A0A(B BBBA 4D AAJ0O DAH  EAJ 4| xAAJ0O DAH  EAJ 4 BAD Io  AABA L X?BBE B(F0A8N 8A0A(B BBBA ,< HAAJ0 AAJ l DKL BBB B(A0A8Dp" 8A0A(B BBBF   {D`j B  ,KD0A A L$ `BBB B(A0A8GZ 8A0A(B BBBK Dt  BBB A(A0G 0A(A BBBF    DD q TZZ\( < (h0P qBAD Gp@  AABF H BBB B(D0A8GP 8A0A(B BBBA 8 dBBA A(G@ (A ABBF L BBE B(D0A8P` 8A0A(B BBBG \xKBB B(D0A8H@V 8F0A(B BBBE N 8A0A(B BBBH G8D0E(B BBBAC@TBBE A(A0G@w 0G(A BBBI  0A(A BBBA LD`BBE B(D0A8OPI 8D0A(B BBBK MDh D \DBBB B(A0A8D@8A0A(B BBBvAL S 'O E I O 4@$'HAA  ABK qCB xD G X H 04Do:P`<'EEB G(C0j (D BBBF s (A BBBF i (D BBBE u (F BBBG M (I BBBL  0D  E a G PbBB A(D0F (A BBBH c(M BBB T~DZ B F J @DgAAG x CAK [ CAA  CAA (AAD  CAD Hh H 0$L,$h7AAF hAA$$rAAI dAALODu G Nl sD E N J Rp$|OAAM }AAbQe J [&Da .D` D D8:HLHBBA A(D0 (C ABBF h(C ABBQprAs l Q IAF _ CG 8BBA A(G0w (C ABBD 44gAAG t CAG D FAM l+)=H2SOp2SO8HAA g KBB a ALB ( <9D\ H P0\(aAD r CF K CB MCd1DU G P$MDQ K T D TMAK$jAAA 0 <D oBBB A(M0 (C BBBC < BBB D(D0I (C BBBH PoH @ H KM wH G A KU T JBB B(A0A8DP 8C0A(B BBBC E d0_D z B K E N$lMd G L D ]4PANhKAIA[8lK0PDK HDG E v J xl_DP D ,,BAI E CBJ G\b B -\P`BBB B(A0A8DP 8D0A(B BBBF 8F0A(B BBB0dAAG ] CAF DFAX\AAD [ AAE } DAF  DAK K CAI [DA9Aw0SAAG m DAE KFA0DyBAF G0  AABK 0xLyBAF G0  AABK 0yBAF G0  AABK ,IAH l CAF `@dBBB A(A0D`x 0A(A BBBD DTJHC ] CBI F FBB XH 4XBBD A(I0|(C ABB0BAD D@r  AABG H, bBBB B(A0A8DP 8C0A(B BBBD TP"lDgl"D"EDA U KBL p ABE  JBA d#BBB B(A0A8D@E 8A0A(B BBBC P 8F0A(B BBBA 0'^(D(AAF@a AAE p(,G`(*I[ L )-)-()IAA AB(T*]BOD sRB,*0@*BAA D0  AABC t +9DtH+0An\+qDl+$+VAAO BAA+DN8 +BBA A(D0\ (C ABBB (X \,AAF l AAJ  ,WDA K 4 4-AAD  FAB ] CAG 0 -AAG r AAK ]FAH !H.rBBD A(I0 (C ABBE f(F ABB8X!|/wEAO zIAO DEA8!/EAO }IAT DEA8!0wEAO zIAO DEA8 "H0EAO }IAT DEA4H"0&AD w FF  FE M CH 4"1BAD  ABH AFB"l2*Ah"2"2"2?D` L N#2?D` L N4<#2oAAG W FAI |AA(t#3WAAK0B AAA 0#D3LAAI l CAE DFA#`3<# 4nAAI i CAH I CAC YCA($<4Q` O H$48\$h5BBA A(Dt (A ABBD $ 9 $9#D^$ 9 D[($(9AAGpo AAA %|9%x9(0%9AO H  C M N \%H:ATl(t%:NBAD CAB(%:-AAM AAH %;eGX A 0%;hBAD L  AABA &8>nAO H H H L@&>BBB B(D0A8G 8A0A(B BBBA H&BBBB B(D0A8J`E 8A0A(B BBBJ L&E BBB B(A0A8D9 8A0A(B BBBA 8,'8PBDA l ABJ A FBG 4h'PAAW l AAI g AAA L'PBBD B(A0A8G 8A0A(B BBBK H'UBBB B(A0A8D` 8A0A(B BBBE 0<(XAAG0z FAF DDALp(XBBB A(C0 (D BBBN A (A BBBH $(Z8AAG eDA(Z;YVH)ZRBBE B(D0A8G` 8A0A(B BBBG L)[A`)\Ht) \BBE B(A0A8D`+ 8C0A(B BBBH d)_BBE B(D0A8DB 8A0A(B BBBE  8A0A(B BBBA 8(*|e@BJA ^ ABB A ABD d*f Hx*|fpBBE B(F0A8O@ 8D0A(B BBBE (*gAAJ0 AAK H*ThMBBB B(A0A8Fp 8A0A(B BBBH <+XnzP+nd+n(x+nAAF0 AAB 0+PrBAH F0  AABE +w4+wAAG  DAH KDA`$,xBBB A(A0f (A BBBK P (A BBBI S (A BBBF ,y;AU J Z, zGdb,Dz=dX,lz;AU J Z,zOD] G $-z6AJ$ AA <-{I{M(T-|Dq K M C M C F-|RPqO@-|"OHA  CBI r JBB CB$-~zAB M F J R.i[M .t;H4.BBE B(A0A8Dp 8A0C(B BBBE H.PBBE B(D0A8DpH 8A0A(B BBBJ ..D h D $.ȇ,AAJ [CA$/ЇA[@/ԇA]\/؇p/ԇ/Ї8/̇BBD A(M@a (A ABBC $/0AC D J F b$/ȈAC D J F b($0`AAD0 AAG $P0AC D J F b0x0LBDA D0^  HABD H0(BBE B(A0A8FPp 8D0A(B BBBH H0BIB B(D0A8N`? 8A0A(B BBBE `D1p:Az E b N  G l D g I ~ J x A @ H O A b H b H H A C41LWBAD C ABC ACB1tKAI12TkLy K O02BD x A L2ؕID  A h2 @|2BHD ~ MBU D ABI ACB`2BBE B(D0A8T@ 8C0A(B BBBH  8D0A(B BBBB H$35 BBB B(A0A8D`x 8A0A(B BBBA Lp3BBE B(A0A8J 8A0A(B BBBE 3bDi K F B 3ԤCDh D R<4sKBF A(G0D(A ABBKH@4DmBBH A(P0t (A ABBI D(C ABB4h#D^4A444/4Х(45eBAA H DBN AABL@5$yBBE B(D0A8G 8D0A(B BBBB 5T H5PBBE B(A0A8DP 8A0A(B BBBJ 5BD}6L6HMDHD46'BBI B(H0A8[@8A0A(B BBB